(data stored in ACNUC10821 zone)

EMBL: AE017262.PLCB

AE017262.PLCB        Location/Qualifiers
FT   CDS_pept        216708..217550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcB"
FT                   /locus_tag="LMOf2365_0216"
FT                   /product="phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="identified by similarity to SP:P09598; match to
FT                   protein family HMM PF00882"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03003"
FT                   /protein_id="AAT03003.1"
FT                   /translation="MCLTASVLVFPVTIKASACCDEYLKPPAAPHDIDSKLPHKLSWSA
FT                   DNPTNTEVNTHYWLFKQAEKILAKDVDHMRANLMNELKNFDKQIAQGIYDADHKNPYYD
FT                   TSTFLSHFYNPDKDNTYLPGFANAKITGAKYFNQSVADYREGKFDTAFYKLGLAIHYYT
FT                   DISQPMHANNFTAISYPPGYHCAYENYVDTIKHNYQATEDMVVKRFCSNDVKEWLYENA
FT                   KRAKADYPKIVNAKTKKSYLVGNSEWKKDTVEPTGARLRDSQQTLAGFLEFWSKKTNE"
     atgtgcttga ccgcaagtgt tctagtcttt cctgtaacga taaaagcaag tgcctgttgt        60
     gatgaatatc taaagccccc cgcagctccg catgatattg acagcaaatt accgcataaa       120
     cttagttggt ccgcggataa tccgacaaat actgaggtaa atacgcacta ttggcttttt       180
     aaacaagcgg aaaaaatact agctaaagat gtagatcata tgcgagctaa tttaatgaat       240
     gaacttaaaa atttcgacaa acaaattgct caaggaatat atgacgcgga tcataaaaat       300
     ccatattatg atactagtac gtttttatct catttttata atcctgataa agataatact       360
     tatttgccag gttttgctaa tgcgaaaata acaggagcca agtattttaa tcaatcggtg       420
     gctgattacc gagaagggaa atttgacaca gcattttata aattgggcct agcaatccat       480
     tattatacgg atattagtca acctatgcac gccaataatt ttaccgcaat atcctatcca       540
     ccaggctacc actgtgcata tgaaaattac gtagatacca ttaaacacaa ttatcaagca       600
     acagaagaca tggtagtgaa aagattttgc tcaaatgacg tgaaagaatg gctctatgaa       660
     aatgcgaaaa gggcgaaagc ggactatccg aaaatagtca atgcgaaaac taaaaaatca       720
     tacttagtag gaaattccga atggaaaaag gatacagtgg aacctactgg agctagacta       780
     agagattcac agcaaacttt ggcaggcttt ttagaatttt ggtctaaaaa aacaaatgaa       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page