(data stored in ACNUC10821 zone)

EMBL: AE017262.PRFA

AE017262.PRFA        Location/Qualifiers
FT   CDS_pept        complement(208997..209710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="LMOf2365_0211"
FT                   /product="listeriolysin regulatory protein"
FT                   /note="identified by similarity to SP:P22262"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02998"
FT                   /protein_id="AAT02998.1"
FT                   /translation="MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGI
FT                   TKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKE
FT                   LLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIK
FT                   ITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLD
FT                   EWFYLACPATWGKLN"
     atgaacgctc aagcagaaga attcaaaaaa tatttagaaa ctaacgggat aaaaccaaaa        60
     caatttcata aaaaagaact tatttttaac caatgggatc cacaagaata ttgtattttc       120
     ctatatgatg gtattacaaa gcttacaagt attagcgaga acgggaccat catgaattta       180
     caatactata aaggtgcttt cgttataatg tctggcttta tcgatacaga aacatcggtt       240
     ggctattata atttagaagt cattagcgaa caggctaccg catacgttat caaaataaac       300
     gaactaaaag aactactgag caagaatctt acgcactttt tctatgtttt ccaaacccta       360
     caaaaacaag tttcatacag cctagccaaa tttaatgatt tttcgattaa cgggaagctc       420
     ggctctattt gcggtcaact tttaatcctg acctatgtgt atggtaaaga aactcctgat       480
     ggcatcaaga ttacactgga taatttaaca atgcaggagt taggctattc aagcggtatc       540
     gcacatagct cagctgttag cagaattatt tctaaattaa agcaagagaa agttatcgtg       600
     tataaaaatt catgctttta tgtacaaaat cttgattatc tcaaaagata tgctcctaaa       660
     ttagatgaat ggttttattt agcatgtcct gctacttggg gaaaattaaa ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page