(data stored in ACNUC10821 zone)

EMBL: AE017262.PROC

AE017262.PROC        Location/Qualifiers
FT   CDS_pept        complement(427515..428315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LMOf2365_0408"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by similarity to SP:P00373; match to
FT                   protein family HMM PF01089; match to protein family HMM
FT                   TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03193"
FT                   /protein_id="AAT03193.1"
FT                   /translation="MKKIGFIGAGNMGTAMIRGLAQANLDNSEAIIVGGRNLEKLKPLE
FT                   AAFTGLQITTDTEKLVEQADIIILAVKPYTIPEILTSVKEQLTPDKIIISVAAGVTIQD
FT                   LEELTSAKTKIVRVMPNTPALVGEAMSSISPNINVSSEEINEVTAIFTSFGEAEVVSEN
FT                   LMDAVIGVSGSSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHP
FT                   GKLKDMVTSPGGTTIEAVKSLENDGFRSAVINAVQAAANKNSSM"
     atgaagaaaa tcggctttat tggcgcaggt aatatgggaa ctgcgatgat tcggggctta        60
     gcacaagcga atttagataa cagcgaagca atcattgttg gtggtcgaaa tctcgaaaaa       120
     ttaaaaccac tggaagcggc atttactggc ctgcaaataa caaccgatac cgaaaaactc       180
     gtagaacaag cagatattat tattttagcg gtgaaacctt acactatccc agaaatttta       240
     acgtcggtaa aagagcagct aacacctgat aaaattatta tttctgtagc agctggcgta       300
     actatccaag atttagaaga actcacttcc gcaaaaacaa aaattgttcg tgtgatgcca       360
     aatacaccag cgcttgtcgg tgaagcaatg tcatctattt cgcctaacat aaacgtatca       420
     tctgaagaaa ttaatgaagt tacagctatt tttactagtt ttggagaagc ggaagttgtt       480
     tccgagaatt tgatggatgc agttattggc gtcagcggtt cttcaccagc ttatgtttat       540
     atgttcatag aagctttagc agacggcgcc gtcctaagtg gcatgcctcg cgataaagca       600
     tataaattcg ccgcacaagc tgtgctaggt gccgcaaaaa cggttctaga aaccggcgaa       660
     catccaggta aacttaaaga tatggttact tctcccggcg gaactacaat tgaagcagtg       720
     aaatcactag aaaatgatgg tttccgttcc gctgttatca atgcagttca agctgctgca       780
     aacaaaaata gttcgatgta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page