(data stored in ACNUC10821 zone)

EMBL: AE017262.PRS-2

AE017262.PRS-2       Location/Qualifiers
FT   CDS_pept        551432..552367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs-2"
FT                   /locus_tag="LMOf2365_0538"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03320"
FT                   /db_xref="GOA:Q723E1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723E1"
FT                   /protein_id="AAT03320.1"
FT                   /translation="MAGKMKLFSVTSERPLATKIADYLDIPLCEVELQKFSDGEVKINI
FT                   EESIRGTNAYVVQSMNSNVNERLMELLIMVDALKRASVHSINIIMPYYGYARQDRKARS
FT                   REPITAKLMANLIQRAGADRLITVDLHAAQIQGFFNIPIDHLSAIPLIGDYLIENYGEK
FT                   DVVVVAPDHSGVVRARRIADRLNAPIAILNRKPRPHEDEIMSVIGDVKGKVAIVVDDII
FT                   DTGVRATTSADILLEKGAVEVIACATHSVMAGNATERLQNSNIKEVITSDSIDLPEDKQ
FT                   FDKLTTISIGRILGRAIEGVQENRSLHPLF"
     atggcaggca aaatgaaact tttttctgtg acgagtgaga gaccacttgc gacaaaaatt        60
     gcagattatc tagatatacc tttatgtgag gtggagctcc agaagttcag tgatggagaa       120
     gtgaaaatta atattgagga aagtatccgt ggaacgaatg cgtatgttgt gcaatcaatg       180
     aattccaacg taaacgaacg tctaatggaa cttttaatca tggtagatgc cttaaaacgc       240
     gcttccgtgc attccatcaa tataattatg ccttattatg gctatgctcg tcaggacaga       300
     aaagctcgct caagagaacc aattaccgcc aaattaatgg caaatctaat tcaaagagct       360
     ggagccgacc gtttaatcac agtagattta cacgcagctc aaattcaagg ctttttcaac       420
     attccaatcg atcatctttc agcaattccg ctaattggtg attatttgat agaaaattac       480
     ggtgaaaaag acgtggtagt tgtcgcgccg gatcacagtg gcgtagttcg cgcacgcaga       540
     atcgcggacc gactaaacgc gccaatcgcc attttaaacc gtaaaccaag accacatgaa       600
     gacgaaatta tgagtgtcat tggcgatgtg aaaggcaaag tcgcaatcgt tgtcgatgat       660
     attatcgata ccggcgtccg tgccactact tcagctgata ttttacttga aaaaggtgcc       720
     gtagaagtta tcgcttgcgc aacccactcc gtcatggcag gaaatgcaac cgaacgctta       780
     caaaattcca atatcaaaga agtcatcaca tcggactcca tcgatcttcc agaagataaa       840
     caattcgaca aactaacaac catctccatc ggacgaatct taggccgcgc aatcgaaggc       900
     gtacaagaaa accgctcgtt gcatccgttg ttttaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page