(data stored in ACNUC10821 zone)

EMBL: AE017262.PTH

AE017262.PTH         Location/Qualifiers
FT   CDS_pept        222382..222942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="LMOf2365_0224"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03011"
FT                   /db_xref="GOA:Q724K0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K0"
FT                   /protein_id="AAT03011.1"
FT                   /translation="MKLIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGM
FT                   TSEIIVGGEKMILVKPLTFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSIIQHVKTQEFNRIRVGVSRPLKGEVIHYVLGDFPKAEQPDIIAAIQK
FT                   SADAIEDFAQTPFIEVMNKYNQK"
     atgaaactaa tcgcaggact cggaaacccg ggcaaaaaat acgaacgtac ccggcataat        60
     gtcggtttta tggtagttga cgaactaagt tttcgtcatc aaaccccttg gaagaaatca       120
     aaatttaatg gtatgactag cgaaattatc gtcggcggtg aaaaaatgat tttagtgaaa       180
     ccactcactt ttatgaacgc ttcaggtgaa tgcattcgtc cgctaatgga ttactacaac       240
     ataccaattg aagatgtcgt gattgtgtat gatgatctcg atttaccagt tgggaagatt       300
     agattacgcc aaaaaggtag tgctggcgga cataatggaa tgaaatcaat tattcaacac       360
     gttaaaacac aagagtttaa tcgcattcgt gttggcgtta gtcgtccttt aaaaggagaa       420
     gttattcatt atgtcttggg agattttcct aaagcagaac aacctgatat tatcgcagcg       480
     attcaaaaaa gcgctgacgc catcgaagac tttgcacaga caccatttat agaagttatg       540
     aataaataca atcaaaaata g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page