(data stored in ACNUC10821 zone)

EMBL: AE017262.QOXD

AE017262.QOXD        Location/Qualifiers
FT   CDS_pept        22006..22338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="LMOf2365_0019"
FT                   /product="quinol oxidase AA3, subunit IV"
FT                   /EC_number="1.9.3.-"
FT                   /note="identified by similarity to SP:P34959; match to
FT                   protein family HMM PF03626"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02808"
FT                   /protein_id="AAT02808.1"
FT                   /translation="MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYSTLTT
FT                   NVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIG
FT                   HMNHLL"
     atgacacaaa ataataaatc aaatgcagct catgctgaag gtggcattcc ttggaaacat        60
     attgttggct ttgcgttatc agttattttg acgcttctag cagtctgggt ggctctttat       120
     tcgacgctaa caacaaatgt taaggtagtt attattttca tctttgcgtt cattcaggca       180
     gccttacagc ttctgatgtt catgcacatg acagaaggcc gcgatggtaa aattcaaatc       240
     ggtaatattt tattcgccgc atttatcgcg attgtcgtag ttattggttc ttattgggta       300
     atggaaattg gccatatgaa tcatttgtta taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page