(data stored in ACNUC10821 zone)

EMBL: AE017262.RADA

AE017262.RADA        Location/Qualifiers
FT   CDS_pept        258462..259835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LMOf2365_0245"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by similarity to SP:P37572; match to
FT                   protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03032"
FT                   /protein_id="AAT03032.1"
FT                   /translation="MAKAKRTTKFVCQACGYESAKWMGKCPNCNEWNQMVEALEPSKKS
FT                   RSAFNHTGEPSKATPITQIASETEKRVETNMPELNRVLGGGVVPGSMVLVGGDPGIGKS
FT                   TLLLQVSAQLTLTNKKVLYISGEESIKQTKLRAERLQVSGDNLYVYAETNLEAVQETID
FT                   FVKPDFVVIDSIQTVYHPDVTSAAGSVSQVRECTATLMRIAKMQNIAIFIVGHVTKEGA
FT                   IAGPRLLEHMVDTVLYFEGERHHAYRILRAVKNRFGSTNEMGIFEMRDVGLVEVANPSE
FT                   VFLEERLEGASGSTVVASMEGTRPVLVEIQALVSPTMFGNAKRMATGIDYNKVSLIMAV
FT                   LEKRVGLMLQNQDAYLKAAGGVKLDEPAVDLAVAVSVASSYRDKPTRSTDCFIGELGLT
FT                   GEIRRVARIEQRVQEAAKLGFKRIFIPKNNEGNWKIPKDVQVVGVETIGEALKKALPD"
     atggctaaag caaaaaggac aaccaaattt gtgtgtcagg catgtggata tgaatcggca        60
     aaatggatgg gaaaatgtcc gaattgcaac gagtggaatc agatggtaga agctttggag       120
     ccgtcaaaaa aatcacgctc agcttttaat catacgggag aaccttcgaa agcgactcca       180
     attactcaaa tagcaagtga aacagaaaaa cgtgtcgaaa ccaatatgcc ggagttaaat       240
     agagttcttg gcggaggtgt ggttccagga tctatggtac ttgtcggtgg ggatcctggt       300
     atcgggaagt cgactttatt actgcaagtt tcagctcaac tgacgctcac aaataaaaaa       360
     gtattgtata tatcaggaga agaatctatc aaacaaacga agctgcgggc ggaacgcttg       420
     caagtttcgg gagataattt atatgtgtat gcagaaacaa atttagaagc agttcaagaa       480
     acgattgatt ttgtgaagcc tgattttgta gtcattgact ccattcagac tgtttatcat       540
     cccgatgtta caagtgcagc ggggagtgtt tcgcaagtta gggaatgtac agcgacattg       600
     atgcgaattg ctaaaatgca aaacattgca atctttattg ttggacatgt aacaaaggaa       660
     ggtgctattg cggggccgcg cctacttgaa catatggttg atactgtgct ttattttgaa       720
     ggggagcgtc atcatgctta ccggattttg cgtgcagtga aaaaccgttt tggttccact       780
     aatgaaatgg gtatatttga aatgcgagat gttggacttg tagaagttgc taatccttcc       840
     gaagtgttct tggaagaacg tcttgaaggc gcttcaggtt caacggttgt agcttctatg       900
     gaaggaactc gccccgtcct tgtggaaata caagcgcttg tttcgcctac gatgtttggt       960
     aatgctaagc gaatggcgac aggaatagac tataataaag tttcgctaat tatggctgtt      1020
     ttagaaaagc gagtaggttt aatgttgcaa aaccaagatg cttatttgaa agcagctggt      1080
     ggggttaaat tggatgaacc tgcagtggat ttggcggttg cagtcagtgt tgcatctagc      1140
     tatcgtgata aaccaacaag aagtacggat tgctttattg gagaacttgg acttacaggt      1200
     gagattcgtc gtgttgcaag aattgaacaa cgcgtacaag aagccgcaaa acttggcttt      1260
     aagcgaattt ttattcctaa aaataacgaa ggtaattgga aaataccgaa agacgtgcaa      1320
     gtggttgggg tggaaacgat tggagaagct ttgaagaaag ctttaccaga ttaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page