(data stored in ACNUC10821 zone)

EMBL: AE017262.RPIB-2

AE017262.RPIB-2      Location/Qualifiers
FT   CDS_pept        542537..542986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB-2"
FT                   /locus_tag="LMOf2365_0527"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by similarity to SP:P37351; match to
FT                   protein family HMM PF02502; match to protein family HMM
FT                   TIGR00689; match to protein family HMM TIGR01120"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03309"
FT                   /protein_id="AAT03309.1"
FT                   /translation="MEIAIAADHGGFQLKEKIRAHLIESGYTVKDFGCYSLESVDFPEY
FT                   AAKVGHFVATENSLGVLCCGTGIGMSMAANKIKGVRAAVVSDAFSAMMTRRHNNSNVLC
FT                   LGERVLGDSLALLLLDTWLAAEFEGGRHNTRLAKLAELEEPEEDK"
     atggaaattg caattgcagc tgaccatggc ggatttcagt tgaaagaaaa aatccgcgcg        60
     catttaattg aaagcggcta cacagtaaaa gattttggtt gttattcatt agaaagcgtg       120
     gattttccag agtatgccgc taaagtagga cactttgttg caaccgaaaa cagtttaggt       180
     gtgctctgtt gcggaacagg gattggaatg tctatggcag ccaacaaaat aaaaggtgtt       240
     cgtgctgctg ttgtttcaga tgctttttca gcaatgatga cgaggcgaca taataatagt       300
     aatgttcttt gtcttggtga acgtgttctg ggcgatagtc tggcgttact cttacttgat       360
     acgtggcttg cggcagaatt tgaaggtgga agacataata caaggctcgc gaaattggcg       420
     gagcttgagg aaccggagga agataaatga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page