(data stored in ACNUC10821 zone)

EMBL: AE017262.RPLA

AE017262.RPLA        Location/Qualifiers
FT   CDS_pept        270755..271444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LMOf2365_0261"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03048"
FT                   /db_xref="GOA:Q724G3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G3"
FT                   /protein_id="AAT03048.1"
FT                   /translation="MAKKGKKYQDALKQIDANKVYTAEEAVELAKKIDFAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGESEFVEKI
FT                   NQGWFEFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVTKAVNEIKAGKVEY
FT                   RVDKAGNVHAAIGKVSFDAAKLVENFRTVNDVLQKAKPAAAKGTYVKNLSVTTTFGPGI
FT                   KVDPASL"
     atggctaaga aaggcaaaaa gtatcaagat gctttaaaac aaattgatgc aaacaaagtt        60
     tacactgcag aagaagcagt tgaacttgct aaaaaaattg acttcgctaa attcgatgca       120
     actgttgaag tagcattccg tcttggcgtt gaccctaaaa aagcggacca acaaatccgc       180
     ggtgctgttg tattaccaaa cggtactggt aaaactcaac gcgtattagt attcgcaaaa       240
     ggtgaaaaag ctaaagaagc tgaggctgct ggagctgatt acgttggtga atctgaattc       300
     gttgaaaaaa tcaaccaagg ttggtttgaa tttgacgtta tcgttgctac acctgacatg       360
     atgggtgaag ttggtaaatt aggccgtgtc cttggaccaa aaggtttaat gccaaaccct       420
     aaaactggta cagtaactat ggacgtaact aaagcagtta acgaaattaa agctggtaaa       480
     gtagaatacc gtgttgataa agctggtaac gtccacgctg caatcggtaa agtatctttt       540
     gatgctgcta aactagtaga aaacttccgt actgtgaatg acgttctaca aaaagcaaaa       600
     cctgctgctg cgaaaggtac ttacgtgaaa aatctttccg taacaactac tttcggacct       660
     ggaatcaaag tcgacccagc tagcttataa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page