(data stored in ACNUC10821 zone)

EMBL: AE017262.RPLK

AE017262.RPLK        Location/Qualifiers
FT   CDS_pept        270290..270715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LMOf2365_0260"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03047"
FT                   /db_xref="GOA:Q724G4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G4"
FT                   /protein_id="AAT03047.1"
FT                   /translation="MAKKVIKEVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAKVEKGSGEPNKTKVASVTRAQ
FT                   VQEIAETKMPDLNAANVESAMLMVEGTARSMGITIQD"
     gtggcaaaaa aagtgattaa agaagttaaa cttcaaattc cagcaggtaa agcaaatcct        60
     gcacctccag ttggacctgc attaggtcaa gctggcgtaa acatcatggg attctgtaaa       120
     gagtttaatg ctcgcacagc cgatcaagct ggtcttatta ttcctgttgt gatcactgta       180
     tttgaagacc gttcgtttac gttcatcact aaaactccac cagcagctgt attacttaaa       240
     aaagcagcta aagtggaaaa aggatccggt gaaccaaaca aaacaaaagt tgcatctgta       300
     actcgcgctc aagtacagga aattgctgaa acaaaaatgc cagaccttaa cgctgcaaat       360
     gttgaatctg caatgctaat ggttgaaggt actgcacgtt ctatgggtat cactatccaa       420
     gactaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page