(data stored in ACNUC10821 zone)

EMBL: AE017262.RPMF-1

AE017262.RPMF-1      Location/Qualifiers
FT   CDS_pept        531418..531588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF-1"
FT                   /locus_tag="LMOf2365_0516"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03298"
FT                   /db_xref="GOA:Q723G3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G3"
FT                   /protein_id="AAT03298.1"
FT                   /translation="MAVPARRTSKAKKNKRRTHKGLTTPGLSRDSETGEYRMSHRISPD
FT                   GTYKGRTIIEK"
     atggcagttc cagctagacg tacgtccaaa gcgaagaaaa acaagcgccg tacgcataaa        60
     ggcttaacaa caccaggttt gagccgcgat agtgaaacag gcgaataccg tatgtcacac       120
     cgcatctcac cagacggcac ttataaaggt cgcacaatta tcgaaaaata a                171
//

If you have problems or comments...

PBIL Back to PBIL home page