(data stored in ACNUC10821 zone)

EMBL: AE017262.RPMG-1

AE017262.RPMG-1      Location/Qualifiers
FT   CDS_pept        268627..268776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG-1"
FT                   /locus_tag="LMOf2365_0256"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03043"
FT                   /db_xref="GOA:Q724G8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724G8"
FT                   /protein_id="AAT03043.1"
FT                   /translation="MKKKTSLACSECGSRNYTVNVSGTQKETRLEVKKFCRHCNKHTLH
FT                   RETK"
     atgaagaaga aaacatccct cgcttgttct gagtgtggtt caagaaacta tacagtcaat        60
     gttagcggga cgcagaaaga aacgcgttta gaagtgaaga aattctgccg acactgcaat       120
     aaacatacat tacatcgaga aacaaaatag                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page