(data stored in ACNUC10821 zone)

EMBL: AE017262.RPOB

AE017262.RPOB        Location/Qualifiers
FT   CDS_pept        283309..286863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LMOf2365_0274"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37870; match to
FT                   protein family HMM PF00562; match to protein family HMM
FT                   PF04560; match to protein family HMM PF04561; match to
FT                   protein family HMM PF04563; match to protein family HMM
FT                   PF04565; match to protein family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03061"
FT                   /db_xref="GOA:Q724F0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724F0"
FT                   /protein_id="AAT03061.1"
FT                   /translation="MSGHSGHDVKYGRHRTRRSFARISEVLELPNLIEIQTASYQWFLD
FT                   EGLREMFRDISPIEDFAGNLSLEFIDYDLGEPKYSVEESKNRDANYAAPLRVKLRLINK
FT                   ETGEVKDQEVFMGDFPLMTEMGTFIINGAERVIVSQLVRSPGVYFNGKLDKNGKKGFGS
FT                   TVIPNRGAWLEYETDAKDVVHVRIDRTRKLPVTVLLRALGFGSDQEIIDLIGDNDYLRN
FT                   TLEKDNTDNAEKALLEIYERLRPGEPPTVDNARSLLVSRFFDPKRYDLASVGRYKINKK
FT                   LHLKNRLFNQTLAETLVDPETGEIIASKGDILDRRNLDQIIPNLENGVGFRTLRPTDGV
FT                   MEDSVLVQSIKIYAPNDEEKEINIIGNAYIEENVKHITPSDIISSISYFFNLLHGVGDT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDMTTITPQQLINIRPVVAS
FT                   IKEFFGSSQLSQFMDQTNPLGELTHKRRLSALGPGGLTRERAGYEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSSFAKVNKFGFIETPYRRVDPETNRVTDKIDYLTADEEDNYVVA
FT                   QANSKLDEQGTFTEEEVMARFRSENLAVEKERIDYMDVSPKQVVSVATACIPFLENDDS
FT                   NRALMGANMQRQAVPLMHPEAPFVGTGMEHVSAKDSGAAVTAKHDGIVEHVEAREIWVR
FT                   RVSLVDGKEVTGGIDKYTLRKFVRSNQGTCYNQRPNVAEGDRVVKGEILGNGPSMDSGE
FT                   LALGRNVLVAFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEFESEARDTKLGPEEMTR
FT                   DIPNVGEDALRDLDERGIIRVGAEVKDNDLLVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGGGIVLDVKIFTREAGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPFMPDGTPVDIMLNPLGVPSRMNIGQVLELHLGMAARALGIHVA
FT                   TPVFDGANEEDVWSTVEEAGMARDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDVVGR
FT                   VKTYEAIVKGESVPEPGVPESFKVLIKELQSLGMDVKMLSADEEEIEMRDMDDDDFTNQ
FT                   NDAFNIVQPENAAAEKTE"
     ttgtcaggac attcaggaca tgatgtaaaa tatggacggc atcgtacgcg tagaagtttt        60
     gcgcgaatca gtgaagtact tgaattacca aacttaattg agattcaaac agcttcttac       120
     caatggttct tagatgaagg gctacgtgag atgttccgcg atatttcgcc aattgaggat       180
     tttgcgggta atttatcttt agaattcatt gattacgatc ttggagaacc gaaatactcg       240
     gtagaagaat ctaagaaccg tgatgcaaac tatgcggctc cactacgcgt gaagttgcgc       300
     ctaatcaaca aagaaaccgg cgaagtgaaa gaccaagaag tatttatggg tgatttcccg       360
     ctaatgactg aaatgggtac gttcattatt aatggggcag aacgtgttat cgtttcccaa       420
     ttagttcgtt ctccaggtgt ttacttcaat ggaaaactag acaaaaatgg taaaaaaggc       480
     tttggttcta ctgtcatccc taaccgtggg gcttggcttg agtacgaaac agatgctaaa       540
     gacgttgtac acgttcgtat tgaccgtaca cgtaaattac cagtaactgt tttacttcgt       600
     gcactaggct ttggttccga tcaagaaatt attgatttaa tcggggacaa tgactacttg       660
     cgcaacacgc ttgaaaaaga caacactgac aatgctgaaa aagcacttct agaaatttac       720
     gaaagattac gtccgggtga acccccaaca gttgataacg ctagaagctt actagtttct       780
     cgtttctttg atccaaaacg ctacgatctt gcaagcgttg gacgttataa aatcaacaaa       840
     aaattacatc tgaaaaaccg tctattcaac caaacattag cagaaacttt agtggatcca       900
     gaaactggtg aaattatcgc ttctaaaggt gacattttgg atcgtcgtaa tttagatcaa       960
     attattccta atttagaaaa cggtgtaggt ttccgtacac ttcgtccaac tgatggagtt      1020
     atggaagata gcgtactcgt tcaatctatt aaaatctacg caccaaatga tgaagaaaaa      1080
     gaaatcaaca tcattggtaa tgcgtatatt gaagaaaacg taaaacacat cacgccttct      1140
     gatattattt catccattag ctacttcttt aacttgctac atggtgttgg cgatacagat      1200
     gacatcgatc acctaggtaa tcgtcgtctt cgttctgttg gtgaactttt acaaaaccaa      1260
     ttccgtatcg gtttatcccg tatggaacgt gtagttcgtg agcgtatgtc tattcaagat      1320
     atgactacaa ttacaccgca acaattgatt aatattcgcc cagtagttgc ttctatcaaa      1380
     gaattctttg gtagctcgca gttatctcag ttcatggatc aaacaaatcc acttggcgaa      1440
     cttacgcata aacgtcgtct ttcagcgctt ggacctggtg gtttgacgcg tgaacgtgct      1500
     ggttatgaag tacgtgacgt gcattactct cactatggtc gtatgtgtcc gattgaaacg      1560
     ccagagggac caaacattgg tttgatcaac tccctttctt cctttgcgaa ggtaaataaa      1620
     ttcggcttta tcgaaacgcc ttaccgccgc gtagatcctg aaacaaaccg tgttactgat      1680
     aagattgatt atctaactgc ggatgaagag gataattacg tagtagcgca agctaactcg      1740
     aaattagacg aacaaggtac tttcacagaa gaagaagtta tggctcgttt ccgttcagaa      1800
     aacttagcgg tagaaaaaga acgtattgac tacatggatg tatcgcctaa acaggttgta      1860
     tctgttgcga cagcatgtat tccgttcctt gaaaacgatg atagtaaccg tgcgctaatg      1920
     ggggcgaaca tgcaacgtca agcagttcct cttatgcacc ctgaagctcc atttgttgga      1980
     acaggtatgg aacacgtatc tgcaaaagac tctggtgctg ctgtaactgc caaacatgac      2040
     ggtattgtag aacacgttga agctcgcgaa atctgggttc gtcgtgtatc tctagtggat      2100
     ggcaaagaag taactggcgg aattgataaa tatactttac gtaaatttgt tcgttctaac      2160
     caaggtactt gttataacca acgtccaaac gtagcggaag gtgaccgcgt tgttaaagga      2220
     gaaatccttg gtaacggtcc atcaatggat tccggtgaac tagctcttgg tcgtaacgta      2280
     ctagttgcat tcatgacttg ggatggttat aactacgagg atgcgatcat catgagtgaa      2340
     cgtcttgtaa aagatgacgt ttatacttcg attcatattg aagaattcga atcagaagct      2400
     cgtgatacaa aactcggacc tgaagaaatg actcgtgata ttccaaatgt tggggaagac      2460
     gctttacgcg accttgacga acgtggaatt atccgtgttg gtgctgaagt aaaagacaac      2520
     gaccttctag ttggtaaagt aacaccaaaa ggagttaccg aattaactgc agaagaacgt      2580
     ttattacacg ctatctttgg tgaaaaagca cgtgaagttc gcgatacttc attacgtgta      2640
     cctcatggcg gcggcggaat cgtgcttgac gtgaagatct ttacacgtga agcaggcgac      2700
     gaactaccac cgggtgtaaa ccaattagta cgtgtttata ttgtacaaaa acgtaaaatc      2760
     cacgaaggcg ataaaatggc cggacgtcac ggtaacaaag gggttatctc ccgtatttta      2820
     cctgaagaag atatgccatt tatgccagac ggaacacctg ttgacatcat gcttaaccca      2880
     ctaggggtac catctcgtat gaatatcgga caagtactag agctacactt aggtatggct      2940
     gctcgtgctt taggaattca cgttgcaaca ccagtatttg atggtgcgaa tgaagaagat      3000
     gtttggagca cagtggaaga agctggtatg gcccgcgatg cgaaaacaat tctttatgac      3060
     ggacgttctg gtgaagcatt tgataaccgt atctctgtag gtgtaatgta catgatcaaa      3120
     cttgcccaca tggttgatga taaacttcat gcgcgttcaa ctggacctta ctctctagta      3180
     acgcaacaac cgcttggtgg taaagcacaa tttggtggac aacgttttgg tgagatggaa      3240
     gtatgggcac tggaagctta tggtgctgct tatacacttc aagaaatcct aacgattaaa      3300
     tccgatgacg tggttggtcg tgtgaaaact tacgaagcga ttgttaaagg cgaaagcgtt      3360
     ccagaacctg gtgtgccaga atccttcaaa gtactcatca aagagcttca aagtcttgga      3420
     atggatgtta aaatgctttc cgcagacgaa gaagaaatcg agatgcgtga catggatgat      3480
     gacgacttta ctaatcaaaa tgatgccttc aatatcgtac aaccggaaaa tgcagccgct      3540
     gaaaagactg agtaa                                                       3555
//

If you have problems or comments...

PBIL Back to PBIL home page