(data stored in ACNUC10821 zone)

EMBL: AE017262.RPOC

AE017262.RPOC        Location/Qualifiers
FT   CDS_pept        287034..290639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LMOf2365_0275"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by similarity to SP:P37871; match to
FT                   protein family HMM PF00623; match to protein family HMM
FT                   PF04983; match to protein family HMM PF04997; match to
FT                   protein family HMM PF04998; match to protein family HMM
FT                   PF05000; match to protein family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03062"
FT                   /db_xref="GOA:Q724E9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724E9"
FT                   /protein_id="AAT03062.1"
FT                   /translation="MLDVNNFEYMKIGLASPDKIRSWSHGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECSCGKYKRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVMDMSPRALEEIIYFASYVVTEPGDTPLEKKQLLSEREYRVYREKYG
FT                   KGFSAGMGAEAIKKILADIDLEKETNDLKEELKSAQGQRRTRAIRRLEVMEAFRNSGNN
FT                   PSWMVLDVLPVIPPEIRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVGRGLAHNIKSAKRKIERMAPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAVGEGTIFK
FT                   DINEAQLAYQNGYVHLHSRIAVFAGSIPNERFTDEQRNQLLITTVGKLIFNTILPKSFP
FT                   YINEPTKFNLEIETPAKYFVDTTTDVRAHIAAQELIDPFKKKILGNIIAEVFKKFHITE
FT                   TSKMLDRMKDLGFKISTKAGMTVGIADILTLEEKHEILEKAHDTVEKITKSFRRGLITD
FT                   DERYERVIGVWNAAKDEIQGKLILSLDRLNPIFMMQDSGARGNISNFTQLAGMRGLMAD
FT                   PSGRIVELPITSNFREGLTVLEYFISTHGARKGLTDTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGLTIKAIREGTEIIEPLEERLEGRYSRKTIRHPETKEVIARENDLITEA
FT                   IATQIVDAGIEEVTIRSAFTCNTKHGVCKKCYGKNLATGTEVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAIITEVGGEVVSIEEGRDRQQ
FT                   EITIQGTDDRRSYNIPYTARLRVEEGTIVERGEALTEGSVDPKALIRVRDVLSVQEYLL
FT                   AEVQKVYRMQGVEIGDKHVEVMVRQMLRKIRVMDTGDTNILPGTLMDIHTFTEANRDAI
FT                   LSGSQPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   LGKLVPAGTGIGRYRKLKSEVIKETAEVTDEITNI"
     ttgttagatg ttaataattt tgagtatatg aaaatcggtc tggcatctcc agataaaatt        60
     cgttcatggt ctcatggtga agtaaaaaaa cctgaaacca tcaactacag aacgcttaaa       120
     cctgaacgtg atggcttatt ctgtgaaaga atttttggac caatgaaaga ctgggaatgt       180
     tcttgtggta aatacaaacg tgttcgctat aaaggcgtag tttgtgaccg ttgtggagta       240
     gaagtaacga aatcaaaagt ccgtcgtgaa cgtatgggcc atattgaact cgcagctcct       300
     gtttctcaca tctggtactt caaaggaatt ccaagccgta tgggtcttgt tatggatatg       360
     tccccacgtg cattagaaga aattatctac tttgcatctt acgtggttac agaaccaggc       420
     gatactccac ttgaaaagaa acaactttta tctgaacgtg aataccgcgt ttaccgcgaa       480
     aaatatggta aaggtttctc agctggtatg ggcgcagaag caatcaaaaa aatcttagcc       540
     gatatcgact tagaaaaaga aacaaatgat ttaaaagaag aactaaaatc tgcacaaggt       600
     caacgtcgta ctcgtgcaat tcgtcgtttg gaagttatgg aagctttccg taattccggc       660
     aacaacccaa gctggatggt acttgacgtg ctaccagtta tcccaccaga aattcgtcca       720
     atggtacaac ttgaaggtgg ccgttttgca acaagtgatt tgaatgactt atatcgtcgg       780
     gtaatcaacc ggaacaaccg tttgaaacgc ctacttgatc taggtgcacc aaacattatc       840
     gtgcaaaatg aaaaacggat gctacaagaa gctgtcgatg ctctaattga caacggtcgt       900
     cgtggtcgtc cagtaacagg tccaggtaac cgtccgctta aatccctttc tcatatgctt       960
     aaagggaaac aaggtcgttt ccgtcaaaac ttactaggta aacgtgtcga ttattctggt      1020
     cgttccgtta tcgtcgttgg acctaactta aaaatgtacc aatgtggtct tccaaaagaa      1080
     atggcacttg aattattcaa accatttgtt atgaaagaat tagttggacg cggtttagca      1140
     cataacatta agagcgctaa acgtaaaatc gaacgtatgg ctccagaaat ctgggacgta      1200
     ttagaagaag ttatccgtga acatccggta ttacttaacc gggcgcctac gcttcacaga      1260
     cttggtatcc aagcatttga accaactcta gttgaaggtc gcgcaatccg tcttcaccct      1320
     cttgtatgta cagcttacaa cgctgacttt gatggtgacc aaatggcggt tcacgttcct      1380
     ttatccgcag aagcacaagc agaagcacgt attttaatgc ttgcagcgca aaacattttg      1440
     aaccctaaag atggtaaacc agttgtaaca ccttcccaag atatggtgct aggtaactac      1500
     taccttactt tagaacgtga aaatgctgtc ggcgaaggta ctatcttcaa agatattaat      1560
     gaagcgcaac ttgcgtatca aaacggctat gtacacttac attcacgtat tgctgtattt      1620
     gctggctcga ttccaaatga acgtttcact gatgaacaac gcaaccaatt attaattacg      1680
     actgttggta aattgatttt caacacaatc ttaccaaaat cgttccctta tattaatgaa      1740
     ccaacgaaat tcaacttaga aatcgaaaca ccagctaaat atttcgttga tactacaaca      1800
     gatgtgcgtg ctcacattgc tgcacaagaa ctaatcgatc cattcaagaa gaaaatcctc      1860
     ggtaacatta tcgcggaagt cttcaagaaa ttccatatta ccgaaacttc aaaaatgctt      1920
     gaccgtatga aagatcttgg tttcaaaatc tcgactaagg ccggtatgac agtaggtatt      1980
     gcggatatct taacacttga agaaaaacat gaaattcttg aaaaagcaca tgatactgtt      2040
     gaaaaaatca ctaaatcatt ccgtcgtggt ctgattacag atgatgaaag atacgaacgc      2100
     gttattggtg tatggaatgc tgccaaagac gaaatccaag gaaaactgat cttgagtttg      2160
     gaccgcttaa acccaatctt catgatgcaa gattccggag ctcgtggtaa catttccaac      2220
     tttacacagc tagctggtat gcgtggactg atggctgacc catccggacg tatcgtagaa      2280
     ttgccgatta catctaactt ccgtgaaggt ttaacggtct tagagtactt catttctacc      2340
     catggtgcgc gtaaaggtct taccgataca gcccttaaaa cagccgattc cggttacctt      2400
     actcgtcgtc ttgttgacgt ggctcaagat gttatcattc gtgaagacga ttgtggcact      2460
     gaccgcggtc ttacaattaa ggctattcgt gaaggtactg aaatcatcga accacttgaa      2520
     gaacgtctgg aaggtcgtta ttctcgtaaa acaattcgtc acccagaaac aaaagaagtt      2580
     attgcacgtg aaaatgactt aattacagaa gcaattgcca ctcaaatcgt tgacgctggt      2640
     attgaagaag taactatccg ttctgcattc acatgtaata caaaacacgg cgtatgtaaa      2700
     aaatgttatg gtaaaaactt ggcaactggt acagaagtcg aagttggaga agcagttggt      2760
     atcatcgctg cccaatctat cggggaacca ggaactcagc ttactatgcg tactttccat      2820
     acaggtgggg ttgccggaga cgatatcacg caaggtcttc cacgtattca agaaattttt      2880
     gaagcacgta atccgaaagg gcaagctatc atcactgaag ttggcggtga agttgtttct      2940
     atcgaagaag gtcgtgatcg tcaacaagaa atcactatcc aaggtacaga tgaccgccgt      3000
     tcttacaaca ttccttacac tgctcgcctg cgtgtagaag aaggaactat cgtagaacgt      3060
     ggggaagctc taactgaagg ttctgtggat cctaaagcct tgattcgtgt tcgtgacgta      3120
     ttatccgttc aagaatatct acttgcagaa gtacaaaaag tttaccgtat gcaaggggta      3180
     gaaattggcg ataaacacgt tgaagtaatg gttcgtcaaa tgttacgtaa aatccgcgta      3240
     atggatactg gtgatacaaa catcttacca ggtacattaa tggatattca tacgtttaca      3300
     gaagccaacc gcgacgctat cttaagtggt agccaaccag caacaggtcg tccagttctt      3360
     ctagggatca caaaagcttc ccttgaaact gactccttct tgtctgctgc atcattccaa      3420
     gaaacaactc gtgtcttgac agatgctgca atcaaaggaa aacgtgacga gcttctagga      3480
     cttaaagaaa atgttatcct aggtaaactt gttccagctg gtacaggtat tggtcgttac      3540
     cgcaaactga aatccgaagt tatcaaggaa acagctgaag taactgacga aatcacaaat      3600
     atttaa                                                                 3606
//

If you have problems or comments...

PBIL Back to PBIL home page