(data stored in ACNUC10821 zone)

EMBL: AE017262.SPEG

AE017262.SPEG        Location/Qualifiers
FT   CDS_pept        12257..12775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="LMOf2365_0009"
FT                   /product="spermidine N1-acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="identified by similarity to SP:P37354; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02799"
FT                   /protein_id="AAT02799.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNLHKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYQEMDI"
     atgagtggag atttaaaact tagaccgctt gaacgagaag atttaaaatt tgttcaccgg        60
     ttaaataatg acgcgaaaat aatgtcttat tggtttgaag agccatatga ggcgttcgtc       120
     gagcttcagg agctatatga taagcacatt cacgatcagt cagaacgccg ttttatttta       180
     gaattagatg gccaaatggt tggattagtt gagttaatgg aaattgatta tattcacaga       240
     agagccgaat ttcaaattat tattgatcct aagtttcagg gacatggtta cgctgtttct       300
     gccacaaaac tcgcaatgaa atatgctttt cacgtactaa atctgcataa actatattta       360
     gttgttgata aagtaaatga aaaagctatt catgtctatg aaaaagttgg ttttattcgt       420
     gaaggcgaac taattgatga gtttttcgtt gatggaactt atcatgatgc tattagaatg       480
     tgtattttcc aacatcaata tcaagaaatg gatatttaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page