(data stored in ACNUC10821 zone)

EMBL: AE017262.SPOVG-1

AE017262.SPOVG-1     Location/Qualifiers
FT   CDS_pept        205451..205759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-1"
FT                   /locus_tag="LMOf2365_0207"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02994"
FT                   /db_xref="GOA:Q724L7"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L7"
FT                   /protein_id="AAT02994.1"
FT                   /translation="MEITDVRLRRVETDGRMKAISSITIDGEFVIHDIRVIDGNEGLFV
FT                   AMPSKRTPDGEFRDIAHPINSGTRAKIQEAVLAAYEVADEPAVNEESSADESIVEEN"
     atggagatta cagatgtgag attacgacgt gttgagacag atgggagaat gaaagctatt        60
     tcttcaataa cgattgacgg tgagtttgtt attcacgaca ttcgtgtcat cgatggcaac       120
     gagggtttgt tcgtagctat gcctagtaaa cgtacgccgg atggtgagtt tagagatatc       180
     gctcatccaa ttaactcagg cacccgtgca aaaattcaag aagccgtttt agctgcttat       240
     gaagtagcgg acgaaccagc agtaaacgaa gaaagttctg cagacgaaag tattgtagaa       300
     gaaaactaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page