(data stored in ACNUC10821 zone)

EMBL: AE017262.SPOVG-2

AE017262.SPOVG-2     Location/Qualifiers
FT   CDS_pept        205878..206186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG-2"
FT                   /locus_tag="LMOf2365_0208"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by similarity to SP:P28015; match to
FT                   protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02995"
FT                   /db_xref="GOA:Q724L6"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L6"
FT                   /protein_id="AAT02995.1"
FT                   /translation="MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFV
FT                   AMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE"
     atgcaagtaa cagatgtgag attacgtcgt gtagaaactg atggaagaat gagagcgatt        60
     gcttcaatca ctttagatga ggaatttgta gttcatgata ttcgcgttat tgatgggaat       120
     aacggtttat tcgtagctat gccaagtaaa cgtggtgttg acggtgaatt ccgtgatatc       180
     gctcacccaa tcaattctga cactcgtgca aaaattcaag aagtagtttt agctgaatat       240
     gagcgcgttg gtgaagaaga agcaactgca gtaacagaag aagaatctga atccgtttct       300
     gctgaataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page