(data stored in ACNUC10821 zone)

EMBL: AE017262.SRLA

AE017262.SRLA        Location/Qualifiers
FT   CDS_pept        complement(589108..589629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlA"
FT                   /locus_tag="LMOf2365_0573"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P56579; match to
FT                   protein family HMM PF03608; match to protein family HMM
FT                   TIGR00821"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03355"
FT                   /protein_id="AAT03355.1"
FT                   /translation="MNYIEWFGTNFIGLFEAGGKQFVSFMTGIVPLLIVLLTFTYSIIA
FT                   FIGEERVNRAIQFSAKNMILRYTLMPVLSVLMLTNPMAYTFGRFVKEHQKPAFYDSVVS
FT                   FLHPVTGLFPYANAGELFVYLGIANGVVEAGYSMSSLAVRYFLAGIVVILMRGVITESI
FT                   TKFLMRKEKV"
     gtgaattata ttgaatggtt tggaacaaac tttatcggcc tatttgaggc tggcggcaaa        60
     cagtttgtga gttttatgac aggaattgtc cctcttttaa ttgtcctttt aacctttact       120
     tactcgatta tcgcctttat cggggaggag cgagtcaacc gagcaatcca attttcagcc       180
     aagaacatga ttttgcgcta taccttaatg cccgttttat ccgtactgat gctaacaaat       240
     ccaatggctt atacatttgg tcgttttgtt aaagagcatc agaaaccagc tttttatgac       300
     tccgttgtat cgtttttgca cccagttaca ggattatttc catatgcgaa tgctggtgaa       360
     ttattcgttt atctaggcat tgctaatggt gtggtcgaag ctggatatag tatgtcaagc       420
     cttgcagttc gttacttcct agctggaatc gtggttatat taatgcgtgg tgtgattaca       480
     gaatcaatta cgaaattctt aatgcgaaaa gaaaaagtct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page