(data stored in ACNUC10821 zone)

EMBL: AE017262.SRLB

AE017262.SRLB        Location/Qualifiers
FT   CDS_pept        complement(587732..588082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srlB"
FT                   /locus_tag="LMOf2365_0571"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by similarity to SP:P05706; match to
FT                   protein family HMM PF03829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03353"
FT                   /protein_id="AAT03353.1"
FT                   /translation="MTISKIMEIGPLVPAFEEEKIVILFGPTATNELREISVIHEFQDV
FT                   PNNALTKGNTLLIGEQAYTIEEVGSDANKNLEELGHISVYFRSGQNEVLPGAIVVSPEI
FT                   FPTITVGDSIQF"
     atgactataa gtaaaattat ggaaatcggg ccacttgtcc ccgcttttga agaagaaaaa        60
     atcgttatct tatttggacc aactgctacc aatgaattac gcgaaatatc tgttatacac       120
     gaattccaag atgtaccgaa taacgccctt acaaaaggga acacgttact cattggtgaa       180
     caagcgtata caatagaaga agttggctca gacgcaaaca aaaatctcga agaacttggc       240
     catatttccg tctatttccg ctcaggacaa aatgaagttt taccgggagc tattgttgtt       300
     tctccagaaa tttttccaac aattacggtt ggcgatagta ttcaatttta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page