(data stored in ACNUC10821 zone)

EMBL: AE017262.SSB-1

AE017262.SSB-1       Location/Qualifiers
FT   CDS_pept        56117..56653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb-1"
FT                   /locus_tag="LMOf2365_0054"
FT                   /product="single-strand binding protein"
FT                   /note="identified by similarity to SP:P37455; match to
FT                   protein family HMM PF00436; match to protein family HMM
FT                   PF01336; match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02842"
FT                   /protein_id="AAT02842.1"
FT                   /translation="MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGERE
FT                   ADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTRNYEGNDGKRVYVTEIVAESVQFLE
FT                   PRNSNGGGGNNYQSGNNNNNYNSGGNNFGQAPTNNGGFGQDQQQSQNQNYQSTNNDPFA
FT                   SDGKPIDISDDDLPF"
     atgatgaatc gtgtagtact tgtaggacgc ttaacaaaag atcctgaatt acgttacact        60
     ccagctggtg tggctgttgc gacttttaca ttagctgtaa atcgcacttt cactaaccaa       120
     caaggagaac gagaagctga ctttattaat tgtgttgttt ggcgtaaacc ggcagaaaac       180
     gttgctaatt tcctgaagaa aggaagcatg gcgggcgttg atggccgtgt tcaaactcgt       240
     aattacgagg ggaacgacgg taaacgtgtt tatgtgactg aaattgtagc agagagtgtt       300
     caattccttg aaccgcgtaa ttctaatggc ggtggcggaa ataactatca aagtggcaat       360
     aacaacaata attataatag cggtggaaat aacttcggac aagcacctac aaataacggt       420
     ggattcggac aggaccagca acaatctcaa aatcaaaatt atcaatccac taataatgat       480
     ccttttgcaa gtgatggtaa gccaatcgac atttctgatg acgatttgcc attctaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page