(data stored in ACNUC10821 zone)

EMBL: AE017262.THID-1

AE017262.THID-1      Location/Qualifiers
FT   CDS_pept        354747..355550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-1"
FT                   /locus_tag="LMOf2365_0335"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03121"
FT                   /protein_id="AAT03121.1"
FT                   /translation="MIFKQVLTIAGSDSGGGAGIQADIKTFQERKTFGMSVITAITAQN
FT                   TLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVARNIRLHNFPNIVI
FT                   DPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIEQAAKK
FT                   IFDIGVKAVVIKGGHSKMSEAADFYYDGETTKWLTSERFDTPHTHGTGCTFSACIAAEL
FT                   AKGNSLLDSVMVAKEFITSAIKYPLGIGHGHGPTNHFAYRLEDGK"
     atgattttca aacaagtatt aacgatagct ggttcagatt ctggcggcgg cgcggggata        60
     caagcggata tcaagacatt tcaagagcgt aaaacctttg gcatgtccgt catcacggca       120
     atcacggcac aaaacacgct aggtgtaaaa gcagtgcata aaatcccggt agaaatgatc       180
     cgcgaacagt gcgacgcgat tgcagaggat tttcaagtga gcgccgtgaa aactggaatg       240
     ctagcagatg cagaaattat ccgggaagtg gcgcggaata tccgtttgca caacttccca       300
     aatatcgtca ttgatcctgt gatgattgca aaaggtggca ctgctttgct tgaaaacgag       360
     gcgacacaag tgttgaaaga tgagcttttg ccacttggta cgatcattac gccgaatatt       420
     ccagaagcgg aagaaattct tggtgaaaaa atcacaacca aggcggaaat tgaacaagcc       480
     gctaagaaaa tttttgatat aggtgtaaaa gcggttgtta ttaaaggtgg gcatagcaaa       540
     atgagtgagg cggctgattt ttactatgat ggcgaaacga caaaatggct gacgagcgag       600
     cgctttgata cgccgcatac gcacggaact ggttgcactt tttcggcatg tattgcagct       660
     gaacttgcga aagggaattc gcttttggat agtgtcatgg ttgcgaaaga atttatcaca       720
     agtgcgatta aatatccgct tggaattggt cacggtcatg gtccaaccaa ccattttgcc       780
     taccgattgg aggatgggaa atga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page