(data stored in ACNUC10821 zone)

EMBL: AE017262.THID-2

AE017262.THID-2      Location/Qualifiers
FT   CDS_pept        complement(715740..716555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD-2"
FT                   /locus_tag="LMOf2365_0696"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0696"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03478"
FT                   /protein_id="AAT03478.1"
FT                   /translation="MTIKKTLTIAGSDSSGGAGLQADLKTFEEYGTYGFSAITTIVTMD
FT                   PDNNWAHGVTPIDAQLVREQLKTILSGGPVDAMKTGMLGSIDIIKATREAIDKYDLKNV
FT                   VIDPVMVCKGEDELIQPENAEAIRDLLLPKATITTPNLFEAGQLSGLGKLTTLDDMKKA
FT                   AKKIIELGAKYVVIKGGKALESDKAIDLLYDGKEFTIYEVEKISPSHNHGAGCTFAAAI
FT                   TAGLAKGLTVEEAVAKAKDFVTAAIKGGFALNEFIGPVWHGAYNKAENR"
     atgacaatca aaaaaacatt aactattgca ggttctgatt caagtggtgg tgctggttta        60
     caagcagact taaaaacgtt tgaagaatac ggcacttatg gttttagcgc aatcacaaca       120
     atcgtaacaa tggatccaga taacaactgg gcgcacggcg ttactccaat tgatgcgcaa       180
     cttgttcgcg aacaattaaa aacaatcctt tctggtggtc ctgttgacgc aatgaaaaca       240
     ggtatgctcg gttcaattga catcattaaa gctacacgcg aagccatcga caaatatgat       300
     ttaaaaaatg tcgtaatcga tcccgttatg gtttgtaaag gcgaagacga attaatccaa       360
     ccagaaaacg cggaagctat ccgtgaccta ctgcttccaa aagcaacaat cacaacacca       420
     aacctattcg aagcaggtca attatccggt cttggcaaat taactacatt agatgatatg       480
     aaaaaagcag cgaaaaaaat catcgaatta ggtgctaaat acgtagttat caaaggcgga       540
     aaagccctag aaagcgacaa agcaattgac ctactatatg atggcaaaga atttactatc       600
     tatgaagtag aaaaaatctc tccaagccac aatcacggcg ctggctgtac tttcgcagca       660
     gcaatcacag ctggacttgc aaaaggttta acggttgaag aagcagtcgc aaaagcaaaa       720
     gactttgtca ctgcagctat caaaggtgga tttgcactaa acgaattcat cggtcctgtt       780
     tggcatggcg cttataataa agcagaaaat agataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page