(data stored in ACNUC10821 zone)

EMBL: AE017262.THIE

AE017262.THIE        Location/Qualifiers
FT   CDS_pept        355547..356191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="LMOf2365_0336"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03122"
FT                   /db_xref="GOA:Q723Y9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Y9"
FT                   /protein_id="AAT03122.1"
FT                   /translation="MRAELAVYFIAGTQDIVRGTLPGVLEEALKAGITCFQYREKGAGS
FT                   LQTASERKEMALECQQLCTKYQVPFIINDDVALALEIGADGIHVGQNDEEIRQVIASCA
FT                   GKMKIGLSVHSVSEAEEAERLGAVDYIGVGPIFPTISKADAESVSGTAILEEIRRAGIK
FT                   LPIVGIGGINETNSAEVLTAGADGVSVISAITRSDDCYSVIKQLKNPGYPS"
     atgagagctg aactagctgt atattttatc gctggaacgc aagatattgt tcgtggaacg        60
     ttgccaggtg tgttagaaga agcactgaaa gccggaatta cttgtttcca atatcgcgaa       120
     aaaggagcag gctcactcca aactgcttcc gaaagaaaag aaatggcgct agaatgccaa       180
     caattatgca caaaatatca agtgccattc attattaacg atgatgtcgc cctagccctc       240
     gaaatcggcg cggacggcat ccatgtcggg caaaacgacg aggaaattcg ccaagttatc       300
     gcgagttgcg ctggaaaaat gaaaatcgga ctttcggttc attcggttag tgaagcggag       360
     gaagcagaac gacttggagc ggtggattat atcggcgttg ggcccatttt tcccacgatt       420
     tcaaaagcgg atgcagagtc agtgagtgga acggcaattt tggaagaaat tcgccgggct       480
     ggaattaagc taccaattgt cgggattggc ggaattaatg aaacaaattc agctgaggtt       540
     ctcacagcag gtgcggacgg ggtatcggtt atttcagcga taactcggtc ggatgattgc       600
     tactccgtta tcaagcaatt aaaaaaccca ggttacccct cttaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page