(data stored in ACNUC10821 zone)

EMBL: AE017262.THIM

AE017262.THIM        Location/Qualifiers
FT   CDS_pept        353953..354750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="LMOf2365_0334"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03120"
FT                   /db_xref="GOA:Q723Z1"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723Z1"
FT                   /protein_id="AAT03120.1"
FT                   /translation="MTLEKVWEKGPLVHNITNIVVANDSANGLLAIGASPIMGSAKEEM
FT                   DELAKMADVLVINIGTLDGELVTAMKIAGRAANVAGTPVVLDPVGVGATSYRRKVVQEL
FT                   LAEIQFTAIRGNAGELAAIAGEAWEAKGVDAGVGSADVLSIAEKVANEWSTVVIISGEV
FT                   DVISDGTRFAKVANGSALLPRITGSGCLLSAVCGSFMAVQDDAFRASVEACASYAVASE
FT                   YAEIELERKLPGSFRPQFLDALASWSVEKTRAKAKIQESGEHK"
     atgacgttgg aaaaggtgtg ggaaaaaggg ccgttggtac ataatattac gaatatcgtg        60
     gttgcgaatg actcggcgaa cgggttgctt gcgattggtg cgtcaccgat tatgggttct       120
     gcgaaagagg aaatggatga acttgcgaaa atggcggatg tgctcgtgat taatattggg       180
     acgctagacg gggagcttgt tacagcgatg aaaattgctg gacgtgcggc aaatgttgct       240
     ggaacgccgg ttgtgcttga cccggtcggt gttggtgcga cttcataccg tcgtaaagtg       300
     gtgcaagaat tattggctga aatccagttt acggcgattc gtggaaatgc gggagagctt       360
     gcggcgattg ctggtgaagc ttgggaagcg aaaggcgtgg atgcgggtgt tggttcggcg       420
     gatgtgctga gcattgctga aaaagtggcg aatgaatgga gcacggttgt tattattagc       480
     ggcgaagtag atgtgatttc agacggaacg cgttttgcaa aagtggctaa tggtagcgca       540
     ctgcttccaa gaattactgg ttctggttgt ttgctcagtg cagtttgcgg tagttttatg       600
     gccgttcagg atgatgcttt tcgagctagt gtcgaagcat gcgcgagtta tgcggtggct       660
     tctgagtacg cggaaatcga attagaaaga aaacttccag gttcatttcg accacaattt       720
     ttagatgctc ttgctagttg gtcggtcgaa aaaacgcgtg ccaaagctaa aatccaagaa       780
     agtggtgaac acaaatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page