(data stored in ACNUC30630 zone)

EMBL: AE017283.PE105

AE017283.PE105       Location/Qualifiers
FT   CDS_pept        132955..134664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0110"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81870"
FT                   /db_xref="GOA:Q6ABQ9"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ9"
FT                   /protein_id="AAT81870.1"
FT                   /translation="MFGQFSAAERTSWWGGILAHGHGVRLGGAEITPVEPDLVRTGEGM
FT                   SEMTISDALAERGTIPRVLSIAGTDPSGGAGTAADTKSIIAAGGYAMAVVTSLVAQNTE
FT                   GVRAIHTPPTDFLVQQLAAVSDDVRIDAVKTGMLGTAEIVDAVATFLDEHRPLVVVVDP
FT                   VMVATSGDRLLAPDAEAAMREFCRRATVITPNIPELAVLCQSEPATTPEQAVEQARRWA
FT                   AETGAAVVVKTGHLNSQRVDNMWVTTEGAMHVAPAARVETTNTHGTGCSLSSALATRLG
FT                   AGDTPGDALAWVTDWLHEAIQYGSALNVGKGHGPVDHSHRARRLAEDASAVAWFAPIDP
FT                   LESPQGLVVSAEPAPDAVVAPAGPWTTALWQASGDIARRIEDSDFVAVLVDGTLSKPAF
FT                   EFYLGQDAQYLTYYSRALASLAARAVDPEESVWWAQSSQACLVEEAELHRSWLGDHIDV
FT                   VAGPVTLAYTDFLLARALGDDYVVGTAAVLPCFWLYAHLGAKVPHVPDDHPYASWLQTY
FT                   GDPEFVEGASHTIGLVEKAFQNASAVTRARAAHAYLTACRHELEFFDQALRV"
     gtgttcggtc agttttcagc ggcggagcgc acgtcgtggt ggggtggcat actggcccat        60
     ggacacgggg tgcgcctcgg tggcgctgag atcacacccg tggaacctga tctagttcgt       120
     actggcgaag ggatgtccga gatgaccatt agtgatgcgc ttgccgagcg gggaacaatt       180
     ccccgcgtcc tgtcaattgc gggtaccgat ccgtccgggg gagctggcac cgcagccgac       240
     accaaatcga tcatcgcggc aggtggatat gcgatggctg tcgtcacctc cttggtggcc       300
     cagaacaccg aaggggtgcg cgccatccac accccgccga ccgacttcct ggtccagcaa       360
     ctggccgctg tcagcgatga cgtgagaatc gacgccgtca aaaccgggat gctcggcacc       420
     gctgagatcg ttgacgcggt tgcgaccttc ctcgacgagc atcgaccgct ggtagtcgtc       480
     gtcgatccgg taatggtcgc caccagcggg gaccgcctcc ttgcccccga cgcagaggct       540
     gccatgcgcg agttttgtcg ccgcgcgacc gtcatcaccc cgaatattcc ggagctcgcg       600
     gtgctgtgcc agagcgagcc ggcgacgacc ccggagcagg ccgtggagca ggctcgtcgg       660
     tgggcggctg agacgggagc ggccgtcgtc gtcaagaccg ggcatttgaa ttcgcagcgg       720
     gtcgacaata tgtgggtgac gacggaagga gcaatgcacg tcgccccggc ggcgcgggtg       780
     gagacgacca acacccacgg taccgggtgc tcactgtcct cagccttggc gacccggttg       840
     ggtgccggtg acaccccggg ggatgccctg gcgtgggtca ccgactggct gcacgaggcg       900
     attcagtacg ggtcggcgct gaacgtcggt aagggtcacg gcccggtgga ccactcccat       960
     cgagcacgtc ggctggccga ggacgcttca gcagtggcgt ggttcgcgcc catcgaccca      1020
     ttggaatctc cacaagggtt ggttgtatcg gctgagcctg caccggacgc ggtggttgct      1080
     ccagccgggc catggacgac ggccctgtgg caagcaagtg gggacatcgc gcgtcgcatt      1140
     gaggactcgg attttgttgc cgttctcgtc gacggcacct tgtcgaagcc ggccttcgag      1200
     ttctacctgg ggcaagatgc tcagtacctc acctactatt cacgagcttt ggcatccttg      1260
     gcggctcgtg ctgtcgaccc ggaggagtca gtgtggtggg cgcagtcctc tcaggcgtgt      1320
     cttgtggagg aggcagaact gcaccgctct tggctagggg atcacatcga cgtggttgcc      1380
     gggccggtga ccttggccta cacggacttc ctgctggccc gggcattggg tgacgactac      1440
     gtcgtcggta cggcagcggt actgccttgt ttctggcttt atgcacactt gggtgccaag      1500
     gttccgcacg ttcccgacga ccacccttac gcctcatggt tgcagaccta tggggatccc      1560
     gagttcgtcg agggggcgtc acacaccatc ggtctggtgg agaaagcctt ccagaacgcc      1620
     tccgccgtca ccagggctcg cgctgcccac gcctacctga cggcctgccg tcacgaattg      1680
     gagttcttcg accaagcttt gcgggtctga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page