(data stored in ACNUC30630 zone)

EMBL: AE017283.PE14

AE017283.PE14        Location/Qualifiers
FT   CDS_pept        19324..20301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0016"
FT                   /product="ribose ABC transporter"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81779"
FT                   /db_xref="GOA:Q6ABP9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP9"
FT                   /protein_id="AAT81779.1"
FT                   /translation="MTTTSTATTQRPSVGRKVGSWSLNHGALVGLIILCIALFIATPVF
FT                   LTVPNIINIGIQAAVVAIMAFGMTFVIVTSGIDLSVGSVAALSAMVSAWMFSNAGLPSW
FT                   LTLIIGLLIGLLAGAVSGLAIAYGKLPAFIATLAMMSVARGLTLVISGGTPVATSDAVN
FT                   QLGADVGPIPVPVIMLALAGVVCWFMLSRTVLGRSLYAIGGNEEAARLSGIPVRRILVT
FT                   VYALAGVFAGLAGLVLAGRLSSAQPQAGFGYELDAIAAVVIGGASLSGGSGKASGTFIG
FT                   AVLLAVIRNGLNILNVSSFWQQVVIGCVIALAVGFDVFRSKKES"
     gtgactacta catcaaccgc tactacgcaa agaccgtcag ttggcaggaa agttggttcc        60
     tggtccctta atcacggtgc tctcgtaggc cttattattc tctgtattgc tctgtttatt       120
     gcgactccag tattcctcac tgtgccgaat atcattaata tcggaatcca agccgcggtg       180
     gtggcgatta tggccttcgg tatgaccttc gtcatcgtta cctccggcat tgatttgtct       240
     gtgggttcgg tcgcagctct ttcagccatg gtctcagcat ggatgttctc taacgctggt       300
     ctgccaagct ggctcaccct tatcatcggc ctgctaatcg gactgcttgc tggagctgtt       360
     tccggtctgg ccatcgccta tggcaagttg cctgccttta tcgccacgct ggccatgatg       420
     agcgtcgcac gcggactaac tcttgttatc tctggcggca cccccgtcgc cacctctgac       480
     gcagtgaacc agctgggtgc tgatgttggg ccaattccgg tgcctgtcat catgctcgcc       540
     ctagccggtg tggtgtgctg gttcatgctg tcgcgtacgg tgctggggcg ttctctctat       600
     gccattggtg gtaacgaaga ggctgctcgt ctctccggta ttccggtgcg tcgcatcctc       660
     gtcactgtct acgctctggc cggtgttttt gctggcctag ctggtctggt gttggctggt       720
     cggctctcct cagcccagcc tcaggcgggg ttcgggtatg agcttgatgc cattgcagct       780
     gtcgttattg gtggagcctc attgtcagga ggttctggaa aggcaagcgg cacttttatt       840
     ggtgctgttt tactagccgt tattcgtaac ggtcttaata ttcttaacgt ttcctcgttc       900
     tggcagcagg ttgttatcgg ctgcgttatc gcgctggctg tcggattcga tgtcttcagg       960
     tctaagaaag aatcctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page