(data stored in ACNUC30630 zone)

EMBL: AE017283.PE167

AE017283.PE167       Location/Qualifiers
FT   CDS_pept        complement(210595..211668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0175"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81932"
FT                   /db_xref="GOA:Q6ABD4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABD4"
FT                   /protein_id="AAT81932.1"
FT                   /translation="MLPVLETTAHSPLTIVWFVLITVLWVGFFFLEGFDFGVAMLLPFL
FT                   GRDDKDRRLMVNTIGPTWDGNEVWLLTAGGATFAAFPGWYATMFSGLYLPLLLVLLGLI
FT                   VRGVAFEYRSKNPSSSWRNAFDWMATIGSFLPTLVLGVGFANFVRGLAVGPHSTPDGGT
FT                   APLVTTSFWGLFTPFALIGGILFVVLFCAHGANFVALKTMGDMHDRARKTSAKLGWIAT
FT                   VVALVWALMFNIMYVTRDGRQVLTWIICLLVVVLLAAGSAVVAKGREGLAFLCTALGIA
FT                   LMIVACMFAMYGNLGYRPSGIAFDMWIASATGRTLKIMTISACVFVPIVLAYQVWSYWV
FT                   FRKRLTREAIPDTAVAA"
     atgcttcccg ttcttgaaac tactgcccac tcgcccctga cgatcgtctg gttcgtcctc        60
     atcaccgttc tgtgggtcgg attcttcttc ctcgaaggat tcgacttcgg cgtcgccatg       120
     ctgctgccct tcctgggacg tgacgacaag gatcgtcgtc tcatggtcaa caccatcgga       180
     ccgacctggg acggcaacga ggtgtggttg ctgaccgccg gtggcgctac cttcgccgcc       240
     ttccccggct ggtacgcgac gatgttctcc ggtctgtacc tgccactact actggtgttg       300
     ctcggtctca tcgtccgtgg cgttgccttc gaatatcgtt cgaagaaccc gtcctcctcg       360
     tggcgcaacg ctttcgactg gatggccact attggttcct tcctgcccac cttggtgctc       420
     ggcgtcggct tcgcgaactt cgtccgcggc ctggccgtcg gcccgcactc gaccccagac       480
     ggcggcactg cgccgttagt gacgacctcc ttctggggct tgttcacccc gttcgccctc       540
     atcggcggca ttctgttcgt ggtgctcttc tgcgctcacg gagctaactt cgtcgcgctc       600
     aaaacgatgg gtgacatgca cgaccgcgct cgcaagacct cggccaagct gggctggatc       660
     gccaccgtcg ttgccctggt gtgggccttg atgttcaaca tcatgtacgt cacccgagac       720
     ggacgtcagg tgctcacctg gatcatctgc ctgctcgtcg tcgtgctgct ggccgctggt       780
     tcggcggtcg tcgccaaggg ccgcgagggg ctggctttcc tgtgcaccgc tctgggtatc       840
     gccctcatga tcgttgcctg catgttcgcc atgtacggca acctcgggta ccgcccgtcg       900
     ggtatcgcat tcgacatgtg gattgcctcc gcaaccggcc ggacactgaa gatcatgacg       960
     atcagcgcct gcgtcttcgt gccgattgtg ctcgcctacc aggtctggag ttactgggtg      1020
     ttccgcaagc gcctcactcg ggaggccatc ccggacaccg cggtggctgc ctaa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page