(data stored in ACNUC30630 zone)

EMBL: AE017283.PE173

AE017283.PE173       Location/Qualifiers
FT   CDS_pept        220111..220665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81938"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABC8"
FT                   /protein_id="AAT81938.1"
FT                   /translation="MTIEDGIGWTWVSNQDKEALRGLQSFQCTTDRPKSPGGRALRHPK
FT                   PWELEVQSYFRDRGCGRAKKRGTRRLLLARRSGVIVAAADTEVSISKDGDGSYVNFFIC
FT                   AVAINVSERGKGGRLARELVQVLKDCAVQKAREGGLPRAKVYGRIDANNEPSVHLVDDM
FT                   GFELEQMESVHLQTWSTMLGV"
     gtgacgattg aggatgggat cgggtggacg tgggtctcga accaggataa agaagcgttg        60
     cgaggacttc agtcgttcca atgcaccaca gatcgaccga agtcccccgg gggtagagcg       120
     ctgcgacatc ctaagccgtg ggagctcgag gtccagagtt actttcgcga cagagggtgc       180
     ggaagggcca agaaaagagg cacgcggcgt ttactgctcg cgcggaggag cggggtcatt       240
     gtggccgccg cggacactga agtgagtatt agcaaagatg gcgacggcag ctatgtcaat       300
     ttcttcatct gtgcagttgc cataaatgtg tccgagcgag gcaaaggggg ccgattggcc       360
     agagaactcg tgcaggttct caaggattgc gctgtgcaga aagcgcgtga gggagggctg       420
     ccgagggcca aagtgtatgg gcgcattgac gctaataatg agccgagtgt gcatttggtg       480
     gatgacatgg gattcgagtt ggagcagatg gagtctgtgc atcttcagac ttggtccacc       540
     atgcttggcg tttag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page