(data stored in ACNUC30630 zone)

EMBL: AE017283.PE183

AE017283.PE183       Location/Qualifiers
FT   CDS_pept        complement(231455..232498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81948"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB8"
FT                   /protein_id="AAT81948.1"
FT                   /translation="MHLNLGLAKTINRATHVTRGFRRIVMVTAAGEGRPGRLVADLTNE
FT                   FSRRGIDVSQLPIEGSEDTASSMPAPAHKVLAKWSRHRQGTARHELVESLDHQCALIVT
FT                   DPRRLDEIVGLQAQSDRPVVVLLATDPDDAPDKLAEIVDVVVTPNPQTEPWEHLGVPVH
FT                   SIGVPATGGGPAPGDRPNRIALLGPCTDEQLADALLAFDHACQVVPGWSLEICLDDESR
FT                   ARSAVAARRDVGIHPAGSENTVMNQSELALVMTRKEDLASRILDAAGAGLPAAAYADTP
FT                   AAADILSRCGYPAAGELSSALAQGMADAPLRRIQREYVAEVLADHAGAKIGEAWLDLMF
FT                   NVGRSHH"
     atgcacctca atctcggcct ggccaagacc atcaaccggg caacccatgt cacccgcggc        60
     ttccgccgca tcgtcatggt gaccgccgca ggcgagggcc gccctggccg tctcgtcgcc       120
     gatctcacca acgagttctc ccggcgggga atcgatgtgt cacagctccc gatcgaggga       180
     tccgaggaca ccgcttcgtc aatgcctgcc ccggcacaca aggtgctagc gaaatggtca       240
     cgtcaccgtc aggggacggc gcgccacgaa ctcgttgaga gcctcgacca ccagtgcgca       300
     ctcatcgtta ctgatccccg tcgtcttgac gagatcgtcg gccttcaagc ccagtcggac       360
     cgccccgtcg tcgtcctgct cgccaccgac cctgacgacg ctcctgacaa gcttgcggaa       420
     attgttgacg ttgtcgtcac ccctaacccc cagaccgaac cttgggaaca cctcggcgtc       480
     ccggtgcatt ccatcggcgt cccggcgact ggcggcggtc cggcccctgg cgaccgcccc       540
     aaccgaattg ccctacttgg cccgtgcacc gatgagcagc ttgccgacgc tctcctcgcc       600
     ttcgaccacg cctgccaagt tgtgcccggc tggtccttgg agatctgcct tgacgatgaa       660
     tccagagccc gctcggcagt ggcagcccgc cgcgacgtcg gtattcaccc agctggatcc       720
     gaaaacacgg ttatgaacca gagcgagttg gccctcgtca tgacccgcaa ggaggatctg       780
     gcctcccgaa tcctcgacgc cgctggcgcc ggcctgcccg cagccgctta cgccgacacc       840
     cctgcggcag ctgacatctt gtcgcggtgc gggtaccctg ccgccggcga attgtcgagc       900
     gccctggccc agggcatggc tgacgcaccg ctgcgtcgga tccaacggga gtatgtcgcc       960
     gaggtccttg ccgaccacgc cggcgcaaag atcggcgagg catggctcga cctcatgttc      1020
     aatgttgggc ggagtcacca ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page