(data stored in ACNUC30630 zone)

EMBL: AE017283.PE189

AE017283.PE189       Location/Qualifiers
FT   CDS_pept        complement(237966..239921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0196"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81954"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB2"
FT                   /protein_id="AAT81954.1"
FT                   /translation="MEQIGGLMPASALEALYEHFCASCQYGSLTVGGLFGQYQRWMGLN
FT                   DADVAWLEAVGRAFAAAGGSGSVILADVALEAGLRAAGVSVTRADIQVSSPTLSGIDPA
FT                   TGYIEDPVNSATGNFVLPETDVVFGGPSQGLAISRMYNSTLAAAYDEPEACGVLGPGWS
FT                   TILDQRLIVTDEQARWVRDDGREIVFPLTGRNGASGSPTAEGCHTVEGPWRAAQDNVWI
FT                   SRGDAADLAGVQGATVAGPVWIVADNTGSRLIFTAEGAWVGSTSGAGDGVWIERHDGVI
FT                   TSMHSEWGRSVDLFYAQGRLAKAVASDGRSVSYAYDSQGRLVEVTRPDGVHHYQWDGWL
FT                   LSQVIDASGVAQCVNTFDALGRIRTQRDATGHLTRFTYLPGGVTVADDGQGHHSNTWIS
FT                   DARGRTVGIIDADGQRTSMRYDRYGNLVGATDRAGKVIRHTYNERGHRTRTTLPTGGVI
FT                   EYGWDEADRLTTISTAGTLRARLDYDGTQLTPVRLADPHGTTVTMSWDRGLLRHLTDAT
FT                   GANISVDYDKYGQIMAITNGVGATWQISHDEAGQISQILTPLGYRTEMTHDQAGRLVER
FT                   IDPDGACWSYDYDEAGHLETATAPDGGRTRYTWGPDGQITTITDPTGATTTLAHDEVGD
FT                   LAGIGLPDGGQLGIPA"
     atggagcaaa tcggggggtt gatgcccgcg tcggcgctgg aagcactgta cgagcacttc        60
     tgcgcgagtt gccagtatgg atcattgact gtggggggct tgtttggcca gtaccagcgg       120
     tggatgggcc tcaacgacgc tgatgtggcg tggttggagg cagtgggccg tgcatttgct       180
     gccgctggcg gctccggatc ggtgatattg gccgatgtgg cgttggaggc cgggttgcgg       240
     gccgctgggg tgagtgtgac gcgggcagat attcaggtgt cctcgcccac cttgagtggg       300
     attgatcctg ccactggtta catcgaggac ccggtgaact cggcaaccgg gaacttcgtg       360
     ctcccggaaa cggatgtggt ctttggcggg ccgagccagg ggctggcgat ctcccggatg       420
     tataactcga cgctggctgc cgcctacgat gagcccgagg cgtgtggggt gttagggcct       480
     ggctggtcga ccattctgga tcagcgtttg atcgtcactg atgagcaggc gcgttgggtg       540
     cgcgatgacg gccgcgagat cgttttcccg ctcacgggcc gcaatggcgc cagcggctcc       600
     cccactgctg agggctgcca cactgtcgaa ggaccatggc gggccgccca agacaatgtg       660
     tggatttcac gcggcgatgc tgctgatcta gctggtgttc agggcgctac cgtggctggg       720
     cccgtgtgga tcgttgccga caacactggt agccggctga tcttcaccgc tgagggcgcc       780
     tgggtgggtt cgacctccgg agcgggtgat ggggtgtgga tcgaacgcca tgatggcgtg       840
     atcacttcta tgcactccga gtggggccgg tcggtggatc tgttctacgc gcagggccgt       900
     ctggctaagg ccgtggccag tgatggtcgt agcgtaagct atgcctacga ttcccagggt       960
     cgactggtag aggtaacccg tcctgacggg gttcaccact accagtggga cggctggcta      1020
     ctcagccagg ttatcgatgc gtctggtgtg gcccagtgcg tcaacacctt cgatgcgctc      1080
     ggccggatcc gcacccagcg cgatgccaca ggacacctaa cacggttcac gtatcttcct      1140
     ggtggggtaa ccgtcgccga tgacgggcag ggtcaccatt ccaatacgtg gattagtgat      1200
     gcccggggcc gtaccgtcgg gatcattgat gctgacgggc agcgcacttc tatgcggtat      1260
     gaccgctatg gcaaccttgt gggggctact gatcgagcgg gcaaggttat ccgtcacacc      1320
     tataacgagc ggggacatcg cacccgcacc acactgccca ctggcggggt cattgagtac      1380
     ggctgggatg aggctgaccg gctcaccacc atctcaaccg ccggcacact ccgggcacgc      1440
     ctggactacg acggcacgca actcaccccg gtgcgcctcg ccgatcccca cggcactacg      1500
     gtaacgatgt cgtgggatcg gggcctacta cgccacctaa ccgacgctac tggcgccaac      1560
     atcagtgtcg actatgacaa atatggccag atcatggcca tcacgaacgg ggtcggtgcc      1620
     acatggcaga tcagccacga tgaggccgga cagatcagcc agatcctcac tccgctgggg      1680
     taccgcaccg aaatgaccca tgaccaggca ggccgcctgg tcgagcgtat cgatccggac      1740
     ggggcctgtt ggagctacga ctacgacgag gccggacacc ttgagacagc cacagcccct      1800
     gatggtggac gcacccgcta cacctggggc cctgatggcc agatcaccac gatcactgac      1860
     ccaaccggcg ccacgacgac actggcgcat gacgaggtgg gggatctggc ggggatcggt      1920
     ctacccgacg ggggccagct ggggattcct gcgtga                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page