(data stored in ACNUC30630 zone)

EMBL: AE017283.PE191

AE017283.PE191       Location/Qualifiers
FT   CDS_pept        241522..242385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81956"
FT                   /db_xref="GOA:Q6ABB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABB0"
FT                   /protein_id="AAT81956.1"
FT                   /translation="MVLLAPVVMGAAKFNYGMEIRDEDHVRSTFVYGVSRADLEEAGKK
FT                   PSDFSDCDKTFDVSASEKQHGVKAEFVEDKEYVGCKFTMTTTADDARGAGLGLTFDADK
FT                   VSLSIGRKFFEDARLDKIKVGAFKVSVTFPGKVISHSGSSSVDGNTVTWTDIKDSTSGL
FT                   KAVGERPTGAATAGPSFWKGFGRHGIRGGIIGLIAGIASYFGNKRRAKKKRAKSGGATA
FT                   TAQYPGYGQPQPQEWQAPGQNGHQYGESMNSGGNQPYMQDGRYIGDPWNANSTNTSGFN
FT                   EKPNPR"
     gtggttctgc ttgctcctgt tgtcatgggc gctgcgaaat tcaactacgg tatggagatt        60
     agagatgagg atcacgtccg ctccacgttc gtttacggtg tctctagagc agatctagag       120
     gaggcaggga agaaaccctc agatttctcc gattgcgaca agacgttcga tgtgtctgcc       180
     tccgaaaagc aacacggcgt aaaagctgag ttcgtcgagg acaaggaata cgttggctgc       240
     aaattcacga tgaccaccac tgcagatgac gcgcggggcg ctggattggg attgactttt       300
     gatgcggaca aggtgtcact atctattggt aggaagtttt tcgaggatgc tcggcttgat       360
     aaaatcaagg taggtgcctt taaagtctcg gtgacgttcc ctggtaaggt gatcagccac       420
     tcgggttcaa gcagtgttga cggcaatact gtcacgtgga ccgatatcaa ggactctaca       480
     tcaggattga aggctgtggg cgagcgacct accggtgctg cgacggcggg accgtcattc       540
     tggaagggct tcgggagaca tggcatcaga ggggggatca ttggcctcat tgcgggtatt       600
     gcctcctact ttggtaataa gcgacgtgcg aagaaaaagc gggcgaagtc tggcggggca       660
     actgcgaccg cgcagtaccc gggatacggg cagccgcagc cccaagaatg gcaggctccg       720
     ggtcagaacg gtcaccagta tggggaatcg atgaattccg ggggcaacca accttatatg       780
     caggatggtc gttacatcgg ggacccgtgg aatgcaaatt cgacgaacac ttcagggttt       840
     aacgagaaac ccaatccaag atag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page