(data stored in ACNUC30630 zone)

EMBL: AE017283.PE195

AE017283.PE195       Location/Qualifiers
FT   CDS_pept        complement(245019..247880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0199"
FT                   /product="RHS-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81960"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA6"
FT                   /protein_id="AAT81960.1"
FT                   /translation="MERDLAGRIVALVSPTGLRTSYSYDACGRMVDVTDPAGRVTRYSY
FT                   TSDFQVATVTYPTGETARYEYDAMGRVVLSHVPGAGVSQYRYDPCGRLVFSCDLVYGQR
FT                   HFSYDLAGQLVAATNPAGGVSRYGYDRCGRLVTRTDPGGGLTTYQYNECGQMIAATDPL
FT                   GRVTEYTWDKSGTLAAITRPDGTVVSRRLGPKGVEEYIDDQLVSRILITPTTRTVTIDD
FT                   YTDPAFPWRHLLGYDPRGLLLTHSVAPVPGDESIVDEGPLTSSEQWWYDAEGRRVRHLT
FT                   LTGDSIDYAYTNTGVLGSIRHSRLGEVSLEWDAVGRLAKLGSPLDQQQWGYTDGFVTSH
FT                   TSSRGSTTISRDEMGRVLRVSAPYGDFRYGYDDSGSLTSADGLDGSSRRWVYDTAGRLV
FT                   TTTCQDAGTSQTCHYDYDLAGELVSTVTQLGPGDSTVETHYRYDPCGRRIEAASSAGMR
FT                   EEFRWDSRGWLAGVMTFRAGRSHEFATHVDAFGCLTDVSGPAGRTPIAWDLATGEPQLV
FT                   QVGGIPALPLPDGSVLTPVSADSDQDEPWRRPATDPLDPYTLIQEHLTAGISMTGGHLG
FT                   VAGLAWMGARVYDSTTASFLTIDPLAAPPGSLWEAASYGYAATNPLALADPLGLRPVTD
FT                   AQMRQFASTIDTRNLWDRHIRNVFSWETLGGVALATAGGLLMCFGAEVPGAMLIGAGGD
FT                   MVFQQVVRGHVDYGEVALSGALAPTGGSGLSEIAGLGTRTLLTRGIEAGTTQGYVMGNY
FT                   HWVTSPGPHNAETYLEQVGGETLSGAAFGGITATIGGKTYDALPDSIPTGHFGPHNTIL
FT                   RVGKQPETFIRKYQRNGKLDFGQATSFRGATFKSKIAIKPITTYRSWSDPDYEVGGYVS
FT                   RTRPAGPLQTQLDLALAPQWGNKANHISEYEIPQFAPFYEGAAGVQPVKAIEDSDTLGQ
FT                   LPGGGNQILITDKQVLDRWKSKK"
     gtggagcgcg atctagcggg ccgcattgtg gccctcgtca gccccaccgg gctgcgcacg        60
     agttacagct atgacgcgtg tgggaggatg gttgatgtca ccgatcccgc aggccgcgta       120
     acgcgctatt cctacacctc agatttccag gtggcgacag taacttatcc aactggcgag       180
     accgcgcgct acgagtatga cgccatggga cgtgttgtgc tcagtcatgt tcctggcgct       240
     ggagtgagcc agtaccgata tgacccatgc ggcagactcg tgttcagttg cgatctagtg       300
     tacggacagc gtcacttcag ttacgacctt gccggccaac tggtggcagc gactaacccg       360
     gctggtggcg tctcacggta cggctacgat cggtgtggcc gactcgtcac ccgcaccgat       420
     ccgggtggtg gcctcaccac gtatcagtac aacgagtgcg ggcagatgat cgccgccacc       480
     gacccactgg ggcgagtcac cgaatatacc tgggacaagt ccggaaccct ggccgccatc       540
     acccgcccgg atggcacggt tgtcagccgt cgtcttggcc ctaaaggcgt cgaggaatac       600
     attgatgacc agctggtcag tcgtatcctc atcacgccga ccacccgcac ggtcactatt       660
     gatgactaca ccgatcctgc tttcccgtgg cgccacctgt tggggtacga ccctcgtggg       720
     ctgctcttga cccacagcgt cgcccccgtg ccgggagacg aatcgattgt ggacgagggg       780
     ccactcacct cgtccgaaca atggtggtac gacgccgagg ggcgtcgtgt acgtcatctc       840
     acgttgactg gtgattctat cgattacgca tacaccaaca ccggtgtatt ggggtcgatt       900
     cgccactctc gattgggtga ggtgagcttg gaatgggacg cggtcggtcg tctcgcgaag       960
     ctaggtagtc ctctggatca acagcagtgg gggtatactg atggtttcgt cactagccac      1020
     acctcctccc gcgggtccac gaccatcagt cgcgacgaga tgggccgagt actccgggtg      1080
     agcgcaccat acggggattt ccggtacggg tatgacgatt ccggctcgct cacgtccgcc      1140
     gacggccttg atggatcgag ccgccgatgg gtttatgaca cggcgggacg gctcgtcacc      1200
     acgacgtgtc aggacgccgg caccagtcaa acctgtcact acgactacga cctcgccggc      1260
     gaactcgtca gcacggtgac gcaattgggg cctggtgaca gcacagtaga gacgcactac      1320
     cgatacgacc catgcggccg acgaatcgag gctgcatcct cggctgggat gcgcgaggag      1380
     ttcaggtggg attcacgggg ctggctggcg ggagtgatga ccttccgagc aggtcgctca      1440
     cacgaatttg ccacacatgt cgacgctttc ggatgtctga ccgacgtatc cggtcctgcc      1500
     ggacgaaccc cgattgcgtg ggatcttgcg accggtgaac ctcagctagt ccaggttggc      1560
     ggcataccag cgctgccact tcccgacggc agtgttctga caccagtgag cgcagacagc      1620
     gatcaggatg agccgtggcg tcgcccagcc accgatcccc tcgacccgta tacgttgatc      1680
     caagaacacc tgacggcggg catcagtatg acgggaggtc atcttggtgt agctggtttg      1740
     gcatggatgg gagcgcgcgt ttatgactcc accacggcga gtttcctgac cattgacccg      1800
     cttgcggcgc caccaggatc cttgtgggag gccgccagct acggttacgc cgccaccaat      1860
     ccccttgcgc tagccgatcc attaggcctc agacccgtca ctgatgccca gatgcgccaa      1920
     ttcgctagca ctattgacac ccgaaacctg tgggaccgcc acatccgcaa cgtgttctcg      1980
     tgggagaccc tcgggggtgt tgctctggcc accgccggag gactcctgat gtgttttggg      2040
     gctgaggtgc ccggggcgat gctgatcggc gccggaggcg acatggtttt ccagcaagtc      2100
     gtacgcggcc acgtcgacta tggagaggtt gccttgtccg gagcgttggc acctacggga      2160
     ggctcgggac tcagcgaaat cgcaggtctc ggaactcgaa ctctcctcac ccgcgggata      2220
     gaagccggca caacccaagg ctacgtgatg ggcaactacc actgggtaac atcacccggg      2280
     ccccacaacg ccgaaaccta cctagagcaa gtaggcggag aaacactcag cggcgccgcc      2340
     ttcggaggca tcaccgccac gataggagga aaaacatacg acgccctccc agactcaata      2400
     cccaccggac attttggacc ccataacacg atactccgcg ttggtaaaca gcccgagacg      2460
     ttcattcgaa aataccaaag aaacggcaaa ctggacttcg gacaggcaac ctcattccgt      2520
     ggagccacat tcaaaagcaa aatcgccata aaacccatca caacctaccg tagctggagt      2580
     gacccagact acgaggtcgg cggctacgtg tcccggacac gaccagcggg acccctccaa      2640
     acccaactcg acctagcact ggccccacaa tggggcaaca aggccaatca catctccgaa      2700
     tacgagatac cacaattcgc gccattctac gaaggtgcag ccggagtgca acccgtcaaa      2760
     gccatcgaag actcagacac cttaggccaa ttgcccggag gcggaaacca aatactcatc      2820
     accgacaagc aggtactaga ccgatggaaa tccaagaagt ag                         2862
//

If you have problems or comments...

PBIL Back to PBIL home page