(data stored in ACNUC30630 zone)

EMBL: AE017283.PE199

AE017283.PE199       Location/Qualifiers
FT   CDS_pept        252517..252894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81964"
FT                   /db_xref="GOA:Q6ABA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABA2"
FT                   /protein_id="AAT81964.1"
FT                   /translation="MPGRRVAMDDQRRIITTDRAGSIWAGITWCSLLLFIVAGIIGMMA
FT                   QTMLPANLGYPQLHDSGVPTWLTWTVVGLDVVAFFIPPLVTTSCGRKAKRLGHPVRSAV
FT                   QISWATFTVVTVISFLLVFFG"
     atgcccggga ggagggtcgc tatggacgat cagcgacgca tcatcacgac cgaccgtgct        60
     ggttccatct gggcaggtat cacttggtgc tcgctgttgc tatttatcgt cgccggcatc       120
     atcggaatga tggctcaaac aatgctgccg gccaatctcg gttaccccca gcttcacgac       180
     agcggtgtgc cgacctggct gacctggaca gtcgtcggcc tagacgttgt ggccttcttc       240
     attcccccgc tcgtgaccac ctcgtgcggc cgtaaagcta agcggctcgg ccacccggtg       300
     cgctctgcgg ttcagatctc gtgggccacc ttcaccgttg tgacggtgat cagcttcttg       360
     ctggttttct ttggctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page