(data stored in ACNUC30630 zone)

EMBL: AE017283.PE202

AE017283.PE202       Location/Qualifiers
FT   CDS_pept        256299..256904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0206"
FT                   /product="putative recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81967"
FT                   /db_xref="GOA:Q6AB99"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB99"
FT                   /protein_id="AAT81967.1"
FT                   /translation="MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADA
FT                   LREVKEKAKFCKICFNVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYH
FT                   VLGGAISPLDGKGPADLHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMG
FT                   VTVSRLASGLPVGGDLEYADEVTLGRAFEGRLHVGVGA"
     atgtacgacg gtccgctgca agaactcatt gacgcccttt ctcggctacc ggggatcggg        60
     ccgaagggtg cgcagcggat cgcttttcat atcctcgacg ctcctgcgga ggaggccaat       120
     gaactggccg acgccttgcg cgaggtcaaa gagaaggcca agttctgcaa gatttgtttt       180
     aatgtctcct ccgatgaggt gtgccagtac tgccgtgatc cgcgtcggga ccagtcgatg       240
     atctgtgttg ttgaggagtc caaagacgtt attgctgtgg agcgtacccg acaattccgt       300
     ggtctgtatc acgttcttgg cggagcgatc tcgccgttag acggaaaagg cccagctgat       360
     ctccacatcc gtgaattgtg ccagcggttg gctgacgaaa ccgttaccga ggtgatcctg       420
     gccaccaacc cgaaccttga gggggaagca acggcaacgt atctttcccg cctcatcgcg       480
     cccatgggcg tgacggtgtc ccgactagcc tctggtttgc cggttggcgg cgacctggaa       540
     tacgccgacg aggtcaccct ggggcgcgcc ttcgagggac gcctccatgt gggagttggt       600
     gcctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page