(data stored in ACNUC30630 zone)

EMBL: AE017283.PE213

AE017283.PE213       Location/Qualifiers
FT   CDS_pept        complement(271509..272459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0217"
FT                   /product="conserved membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81978"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB88"
FT                   /protein_id="AAT81978.1"
FT                   /translation="MADVDDDLYAETVLHLDGHHARACIAGDHTNVFLVSRDDEVLESK
FT                   ERPAAGHVPPTAALLQGLSLAKIYDFATTVDIERIEFITEAERLNSALVDAGRDGSYGI
FT                   GEGAAILGSIDRGMASDDLCTRMTAYTAAASDARMGGAPLPAMTNSGSGNQGIVATVPV
FT                   TVAADYAGVDHERRVRALALSHAVALYAHAGLPVLSAFCAATTAAMGAAAGICLVLDGS
FT                   YSAVERAVASMTGDVVGMVCDGAGCSCALKVSASANAAGRAALLSLAGRRVPGTNGLVH
FT                   DDVDAAIRGIGRLGTEGMKQTDPEILSLMMAKQTV"
     gtggccgatg tggacgatga cctctatgcc gaaaccgtcc ttcacctcga tggtcaccac        60
     gctcgagcct gtattgcagg cgaccacaca aacgtattcc ttgtcagccg cgacgacgaa       120
     gtccttgaga gcaaggaacg cccagccgca ggccacgtcc ccccgacggc cgcactcctc       180
     caaggcctca gtctggccaa gatctacgat ttcgctacca ccgtggatat tgagcgcatc       240
     gagttcatta ccgaagccga acgcctcaac agcgccttgg tcgatgctgg acgagacggc       300
     tcctacggga ttggtgaagg tgccgccata ctcggatcga tcgaccgcgg catggcctca       360
     gacgacctgt gcacacgcat gaccgcatac actgcagccg cctcagacgc acgaatgggc       420
     ggtgccccct tgccggcaat gaccaacagt ggatcaggca accaaggcat cgtcgccacc       480
     gtcccagtca ctgtcgcggc ggactacgca ggtgtcgacc acgaacggcg cgtgcgcgcc       540
     ctggccctct ctcacgccgt cgcgctctac gcccacgccg ggcttcccgt gctctccgcc       600
     ttctgtgccg cgaccacagc agcgatgggc gcggcagccg ggatctgcct ggtgttagac       660
     ggctcctaca gcgcggtgga acgcgcagtc gcatcaatga ccggcgacgt cgtcggcatg       720
     gtctgcgatg gtgccggctg cagctgtgcg ttgaaggtct ccgcctcagc gaatgcagcc       780
     ggccgtgccg ccttgctctc gctggcaggc cgacgtgtac ctggaacgaa cgggctggta       840
     cacgatgacg tcgacgcggc gattcgcggc atcggccggc tgggaaccga aggaatgaaa       900
     cagaccgatc cggagatcct gtcgctgatg atggcgaaac agaccgtctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page