(data stored in ACNUC30630 zone)

EMBL: AE017283.PE222

AE017283.PE222       Location/Qualifiers
FT   CDS_pept        278693..279349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0225"
FT                   /product="conserved protein, putative NTP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81987"
FT                   /db_xref="GOA:Q6AB79"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB79"
FT                   /protein_id="AAT81987.1"
FT                   /translation="MSHLSALIASLGRDDPDFSVGRRPGGGRSSAVLALISEEGNDIVL
FT                   TRRPLSLRHHAGQVALPGGRAENTDETIVDTALREAHEEVGLDRRLVTVRGVLPTAHVA
FT                   ASGSDVTTVIATWSGAGTVGVVDPAEVAMVQRVRLADLANPAARATTRHPSGYRGPAFV
FT                   LPDIFVWGFTAHVLDALLDRGGWSRPWDRERMVEIPEGYLGARRLPEEMTPNDIP"
     atgagtcact taagtgccct catcgccagt cttggccgtg acgaccctga tttttcggtg        60
     ggacgacgac ctggcggcgg acgatcctcg gcggtgctgg cccttatcag cgaggaaggg       120
     aacgacattg tcctgactcg acgaccactg tccttgcgtc accatgctgg acaggtagcc       180
     ctacctgggg gtcgggctga gaacactgac gagacgatcg tcgataccgc cctgcgggaa       240
     gcccacgagg aggtgggatt ggacagacgc ctcgtcaccg tgaggggagt gctgccgact       300
     gcccacgtgg ctgctagcgg ctctgatgtc acgaccgtca tcgccacctg gagtggggca       360
     gggacagttg gggtcgtgga tcccgccgag gtggccatgg tgcagcgtgt cagactggct       420
     gacctggcaa atccggcggc tcgtgccacc acacgtcacc cctcgggata tcgcggtccg       480
     gccttcgtcc tacccgacat attcgtgtgg ggattcactg cccatgttct cgacgctttg       540
     ctcgatcgcg gcggatggtc ccggccgtgg gatcgggagc gcatggtgga gattccggaa       600
     ggatatttag gggctcgacg tctgccggag gagatgacgc cgaacgacat tccttga          657
//

If you have problems or comments...

PBIL Back to PBIL home page