(data stored in ACNUC30630 zone)

EMBL: AE017283.PE228

AE017283.PE228       Location/Qualifiers
FT   CDS_pept        284598..285368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81993"
FT                   /db_xref="GOA:Q6AB73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB73"
FT                   /protein_id="AAT81993.1"
FT                   /translation="MTVIGASLLMGLAVWIAMPSATRKQEGRHLPAWSGIPVGFVVAWL
FT                   LFGASGVVWAVMTVVVGEAVLVVVRRQRRRAQILKGGREVARATRALAGRVSVGEIPSV
FT                   ALEHVADDVEVLAQARRAQAVGGSVSDALIATSRQPGMAGLVPLAHAWHLAATTGAPLA
FT                   PAAKSVAEGTARRARLEATLDSELAAARASGRIMGLLPLVGLLMGHVVGAHPTVFLTTT
FT                   WLGRACLLGSTLLACVGVLWSESLADRVAKEALP"
     atgacggtca tcggagcctc cttgcttatg gggttggcag tatggatagc gatgccatcc        60
     gccacaagga agcaggaggg gcggcatcta ccagcgtggt cggggatacc ggtggggttc       120
     gtggtggcct ggttgctttt tggcgcgagc ggtgtggtgt gggccgttat gacagtagtc       180
     gtgggcgaag cggtgctcgt cgttgtgcgc cgtcagcgtc ggagagccca gattcttaaa       240
     ggcggtcgcg aggttgcccg ggcgacaagg gctttggctg gacgggtgtc ggtgggagag       300
     atcccctcag ttgcgctaga gcacgtggct gatgacgtgg aggtattggc ccaggctagg       360
     cgggctcagg cagtgggcgg aagcgtttcc gacgccctca ttgccacctc ccggcaacca       420
     gggatggctg gtctggtgcc actagcccac gcgtggcatt tggcggcgac aacaggtgcg       480
     cccctcgccc cagcggcgaa atccgtggct gaaggaacag ctcggcgagc ccgcctagaa       540
     gccaccctcg actccgaact cgcggcggct cgggcgtcgg ggcggatcat gggtctacta       600
     cctctggtcg gattgcttat gggccatgtc gtcggagcgc atccgacggt gttccttacc       660
     accacatggt tagggagggc ttgcttgttg ggatcgacct tgctggcatg cgttggggtg       720
     ctgtggagtg agtctctggc tgatcgggta gcgaaggagg cactgccatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page