(data stored in ACNUC30630 zone)

EMBL: AE017283.PE230

AE017283.PE230       Location/Qualifiers
FT   CDS_pept        286323..286610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81995"
FT                   /db_xref="GOA:Q6AB71"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB71"
FT                   /protein_id="AAT81995.1"
FT                   /translation="MSENTDPTTEPVISARSLDLVGATDVVEPRHRGRYRAARNKIIDR
FT                   GMATAEYAVGMLAAVALALVLLKVVTHQEVFTKLLKLVVSIIGKAKGMLP"
     gtgtctgaga acaccgatcc aacgacggaa cccgtcatct ctgctaggtc tctcgacctg        60
     gttggcgcta ctgatgtggt agagccccga catcgagggc gttaccgagc agcgcgcaac       120
     aagatcattg atcgtggcat ggctaccgcg gagtacgccg tcggcatgct tgccgccgtc       180
     gcgctcgcgc tggtcttgct caaggtcgtc acccaccagg aggtcttcac gaagctgctc       240
     aaactggttg tcagcatcat tggcaaggca aaaggcatgc tgccgtga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page