(data stored in ACNUC30630 zone)

EMBL: AE017283.PE24

AE017283.PE24        Location/Qualifiers
FT   CDS_pept        complement(28718..29083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81789"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABT9"
FT                   /protein_id="AAT81789.1"
FT                   /translation="MQHPGAIDQVALFQVTHDAPQKAVRDLDVLGSDAVGAGYSHSDLR
FT                   EKFEKSVTALRRASTQSRRNSGMSRGDDNGVEDIEPSSDHRLKSQHKLSCSWHLRPGSG
FT                   MPWSSCRNTTRPSPKVA"
     gtgcagcacc cgggagcgat agatcaagtc gccctgttcc aggtcacgca tgatgcccca        60
     cagaaagcag tccgtgacct agatgtactc ggcagtgacg ccgtgggcgc gggctactcc       120
     cacagcgacc tccgagagaa gtttgagaag tcggtaacgg ccctgcgaag ggcaagcacg       180
     cagagtcgac gcaacagtgg catgtccaga ggtgacgaca acggggtcga agacatcgaa       240
     ccatcgagcg accatcgtct gaagagccag cacaaactca gctgcagctg gcacttgaga       300
     ccaggctccg gcatgccatg gagctcatgc cgcaatacga caaggccatc tcccaaggtg       360
     gcctaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page