(data stored in ACNUC30630 zone)

EMBL: AE017283.PE241

AE017283.PE241       Location/Qualifiers
FT   CDS_pept        298544..299350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82006"
FT                   /db_xref="GOA:Q6AB60"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB60"
FT                   /protein_id="AAT82006.1"
FT                   /translation="MSKAIKRTAADSTDAETTRVIRTGASRVDADVNPTEVIKPSDSAD
FT                   SERTSVIDDNVFRPDSETTRVVDDREFEEERRRRELAEQRARERADRQAIEVERQRRAA
FT                   HAEPEPEQVAEPAPKRTTDKVMASLGLFLFRLIVGGILGVHGFQHLAQRDLTLRAVQAL
FT                   PLPSGYAQSGVWVLGICECIAAVCIILGLFTRVAGAGIIAIMVLSLTFIFWGSFAIFKT
FT                   MGFKGELELLLAACGVLLLFLGAGGWSIDAAYRRSRAAAKAEEVGD"
     gtgagcaagg cgatcaagag gactgcagcg gactccaccg acgccgagac cacccgggtc        60
     atccggacgg gggcctcccg cgtggatgcc gatgtcaacc ccactgaggt gatcaagccc       120
     agtgattcag cggattcgga gcgcaccagc gtcatcgacg acaatgtttt ccgtcctgac       180
     tccgagacga ctcgtgttgt ggacgatcgc gagttcgagg aggagcgtcg ccgtcgcgaa       240
     ttggccgagc agcgcgcccg cgagcgcgcc gaccgtcagg ctatcgaggt cgagcgtcag       300
     cgtcgtgccg cccatgccga gcccgagccg gagcaggttg ctgaaccggc ccccaagcgc       360
     accaccgaca aggtcatggc atccctgggc ctgttcttgt tccgcctcat cgtaggcggg       420
     attcttgggg ttcacggatt ccagcacctc gcccagcgag acctcacatt gcgcgcggta       480
     caggctctcc cactacccag cggatacgcc cagtccggtg tgtgggtgct gggcatctgc       540
     gagtgcattg ccgcggtgtg catcatcctt ggcctgttta cccgcgtcgc gggagccggc       600
     atcattgcga ttatggtgtt gtccttgact ttcatcttct ggggcagttt tgccatcttc       660
     aaaacgatgg gcttcaaggg cgagctggag ctgctgctgg ctgcatgcgg cgtgctgttg       720
     ttgttcctgg gtgccggtgg ctggtccatt gacgccgcct accggcgtag ccgcgctgct       780
     gcgaaggcag aggaggtcgg cgactga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page