(data stored in ACNUC30630 zone)

EMBL: AE017283.PE252

AE017283.PE252       Location/Qualifiers
FT   CDS_pept        311745..312680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0258"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82017"
FT                   /db_xref="GOA:Q6AB49"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB49"
FT                   /protein_id="AAT82017.1"
FT                   /translation="MARRELGPAALAVAQAVERMVRGVDRFVVGCSGGPDSLALALASK
FT                   WASRRCESGVRVVIVDHQLQQGSDEVAERTRDLLVRRGMDACVRRVDVDADDPDGPEAA
FT                   ARTARRAALLDVAGDEPVLLGHTRDDQAEQVLLSLARGSGATSLAGIRPRSGQFWHPLL
FT                   EVRRAQTVQACREWEVEPWQDPHNGDPRFLRSRVRTELMPVMEEVLGPEVAASLARSAT
FT                   LLAGEDEVVARVARMWADEHGVKANELPGLRGVEVGLARRVVKEWLPQARMVHVDAVLG
FT                   LLDGPGGAGVDVPGGRVEMRQGTLYLARRL"
     atggcacgac gggaattagg gccagcggcc ctggcagtcg cccaggccgt cgagcggatg        60
     gtgcgagggg ttgatcggtt cgtcgtcggg tgctcgggcg gtccggactc gctggccttg       120
     gctttggcct caaagtgggc ctcgcggcgg tgcgaatctg gcgtgagggt cgtcattgtc       180
     gaccatcaat tgcagcaggg gtccgacgaa gtggccgagc ggacccggga cttgctggtg       240
     cgacgcggca tggatgcatg tgtgcgtcgc gtcgacgttg acgctgatga ccccgatggc       300
     cccgaggcgg cggcgcggac tgctcgtcgg gcagcactgc tcgacgtcgc tggggatgag       360
     ccggtgttgc tcgggcacac ccgggacgat caggccgagc aggtgttgct ttctctggcc       420
     aggggctccg gggcgacgtc gctggcaggt attcggccgc gttccggtca gttttggcat       480
     ccgctgctag aggtgcgacg ggctcagacg gtgcaggcgt gccgggagtg ggaggttgag       540
     ccgtggcagg accctcacaa tggtgatcca cggttcctgc gctctcgggt gcgcactgag       600
     ctcatgccgg ttatggagga ggtgctgggc ccagaggtgg cggcatccct ggctcgcagc       660
     gcgaccttgc tggcagggga agatgaggtc gtcgcccggg ttgcgcggat gtgggcggat       720
     gagcacgggg tgaaggccaa tgaattgccc ggtttgcgtg gggttgaggt cggcctggcg       780
     cgccgcgtcg tcaaggagtg gctgccgcag gcgaggatgg tgcacgtcga tgccgttttg       840
     ggcttgctcg acgggcctgg tggtgcaggg gtggacgtcc cgggcggacg cgtcgagatg       900
     agacagggga ctctgtatct agcccggcgc ctgtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page