(data stored in ACNUC30630 zone)

EMBL: AE017283.PE257

AE017283.PE257       Location/Qualifiers
FT   CDS_pept        316805..317911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0263"
FT                   /product="putative outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82022"
FT                   /db_xref="GOA:Q6AB44"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB44"
FT                   /protein_id="AAT82022.1"
FT                   /translation="MWNWKMRAAGFIGGLAVVFGFVALPAHSDESVTVPVPLVDAVAVS
FT                   HYESAKRQKEKPGSVILALHAVRRLPYATVVYYSVSVDASVSGPLEDYGYLVGRGGAQA
FT                   HYSGTLSADGAVIDVGNHKLYRTIGDFQGCKMCASEWWNGAPIWEMAPGHSRLGWFSTP
FT                   PLPADVSRVDVTVANRIFHDVPVGDGLLGPTIDKEAATGRWNKGMPLGVAWPALDPKDL
FT                   AGVDVSKFVNALVTTTGDASDASRERVTKESMKIDLDASVLFDLDSDVVKPAGRQIIDR
FT                   TAKQLVARKVSGKIEVTGYTDSSGSASHNLDLSRRRAASVAKVLGSQLSKGITLVTAGK
FT                   GEADPVTSNDSEAGRRLNRRVTITVKEG"
     atgtggaatt ggaagatgag ggcggcaggt tttattggtg ggcttgctgt ggtgtttggt        60
     tttgtggcgt taccggcgca ctctgatgag agtgtcactg tgccggtgcc tctggttgat       120
     gcggtggcgg tgagccatta tgagtcggcc aagcggcaga aggagaagcc ggggtcggtg       180
     attttagcgc tgcacgccgt gcggcgtctt ccgtatgcca cggtggtgta ctactcggtg       240
     tcggtggacg cttcggtgtc tggcccgctt gaggactacg ggtacctcgt cggacgtggc       300
     ggtgctcagg cacactacag cggaaccctc agtgccgatg gtgccgttat cgatgtgggg       360
     aatcataagc tgtatcgcac gattggtgac ttccagggtt gcaagatgtg cgctagcgag       420
     tggtggaatg gtgcaccgat atgggaaatg gctcctgggc attcccggct tggttggttt       480
     agtactccgc cgttgcctgc tgatgtgtcg cgggttgatg tcacggttgc taatcgtatt       540
     tttcatgatg tgccggtggg tgatgggttg ttgggtccca ctattgataa agaggcggcg       600
     acgggtcgct ggaataaggg tatgccgttg ggtgtggctt ggccggcact ggatccgaag       660
     gatctggctg gtgtcgatgt gtcgaagttc gtgaatgcgt tggtgactac gactggtgat       720
     gcttccgatg ctagtcgtga gcgggtgact aaggaatcca tgaagattga tttggatgcc       780
     agtgtgcttt ttgatctgga ctctgatgtg gttaagccgg ctggtcgtca gatcattgac       840
     cggaccgcta agcaacttgt tgctcgcaag gtgtcgggga agattgaggt gactggctat       900
     accgatagta gcggttctgc ttctcataat ctggatcttt cgcgtcggcg ggctgcgtcg       960
     gtggccaagg tcctcggatc gcagctatcc aaagggatca ccttggttac agcgggtaag      1020
     ggggaggctg atccagtgac cagtaatgat tcggaggctg ggcgccgttt gaaccgtcgg      1080
     gtcacgatta ctgtcaagga gggatga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page