(data stored in ACNUC30630 zone)

EMBL: AE017283.PE259

AE017283.PE259       Location/Qualifiers
FT   CDS_pept        complement(318444..318707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB42"
FT                   /protein_id="AAT82024.1"
FT                   /translation="MRSGALEILGQHGPHPDSLHNAALIIATKLSSAPEPVALSLGLAW
FT                   AQASTSSPQRVTGISGDVLADPIAIFTFVTDFGKGGYDACIT"
     gtgcgttctg gtgctctcga aatacttggc caacatgggc ctcatcccga tagtctccac        60
     aatgccgcgc tgatcatagc gacaaagctg tcaagcgcgc ctgagcccgt ggctctaagt       120
     ctgggcctag cttgggccca ggcctcaaca tcgtcccctc aacgagtcac cgggatatca       180
     ggcgacgttt tggccgaccc gatcgcgatc ttcaccttcg tcaccgactt cggcaaaggc       240
     ggatacgacg cctgcataac atag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page