(data stored in ACNUC30630 zone)

EMBL: AE017283.PE260

AE017283.PE260       Location/Qualifiers
FT   CDS_pept        318756..319277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB41"
FT                   /protein_id="AAT82025.1"
FT                   /translation="MANNYGVSRRTLLGVGGLMLGVGLVGCSDSEEGWESVTVDRITVS
FT                   HPTEWVEKPPENENFTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPK
FT                   GYQEITVKGAARAIKCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVD
FT                   KIIASMSFKA"
     atggccaaca actatggcgt gtcgcgtagg acgttgctcg gtgtgggcgg gttgatgctt        60
     ggcgttgggc tggtgggttg ctctgattcg gaggagggtt gggaatcagt aaccgttgat       120
     cgcatcacgg tgagccatcc cacggagtgg gtggagaagc caccggagaa tgaaaatttc       180
     accaagaatt tcactgacgg cccccatggc atgcagattg cgggtcatta cagtgacgac       240
     accgaaccta cgttggcatg gtccgtgctt gaattcatga tccgcgggac gttccagggc       300
     tacgacccca aggggtacca ggagatcacc gtcaagggcg ctgccagggc gatcaagtgc       360
     ccgtttgact tcacttataa ggggaaatct gcgcgagggt attggcttgt tgcttcgggt       420
     gtgttgccca cagagggttc cgcgatcgtg cttctccgtc ttccccgcga tgacacgaat       480
     ctggttgaca aaattattgc gtcgatgtcg ttcaaggcgt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page