(data stored in ACNUC30630 zone)

EMBL: AE017283.PE263

AE017283.PE263       Location/Qualifiers
FT   CDS_pept        320859..321536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0270"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to predicted gland protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82028"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB38"
FT                   /protein_id="AAT82028.1"
FT                   /translation="MSSPRAVPKAPISAWMVTSKFELGKPRLVPGPGKPRLVSGPGKPR
FT                   LVSGPGKPRPVPGPVRWKPEPNKTRDAGNNEGRHGKQGKGSTLSKKPGREEESDGDHKS
FT                   RETTTIRVAVNDQNRSQVEKWLGDNDVGPSNAVPLLVKARFMNPLDADATNDFAKFLYQ
FT                   SEDTQIDTQTSSETSDLKDDSYDILVAKVGEKDARESSSSTGQMGYLLENGKRVPKISE
FT                   GCK"
     ttgtcatcac caagagcggt gccgaaggcg ccgatttcgg cgtggatggt gacttcaaaa        60
     tttgagctgg gtaagccgag gcttgttcct ggtccgggta agccgaggct tgtttctggt       120
     ccgggtaagc cgaggcttgt ttctggtccg ggtaagccga ggcctgttcc tggtccagtt       180
     aggtggaagc ctgagcccaa taagactcgc gatgccggta acaacgaggg ccgccacggc       240
     aagcagggca aggggagtac tttgtctaag aagccgggtc gcgaggagga gtccgacggt       300
     gaccacaaga gtcgtgagac gaccaccatc cgggtagccg tcaacgacca gaaccggagt       360
     caggtcgaaa agtggctcgg ggataacgat gtcggcccct ccaacgcagt gccactgctg       420
     gtcaaggcgc ggtttatgaa cccgctggac gctgacgcca ctaacgactt cgctaagttt       480
     ctttaccagt ctgaggacac ccagatcgac acgcagacga gcagtgagac ttccgatttg       540
     aaggacgatt catatgacat tttggtcgcg aaggtcggag aaaaagatgc tagggaatcc       600
     agttcgtcca ccggtcagat gggttatctc ttggagaacg gcaaacgtgt ccccaagatt       660
     agtgaggggt gcaagtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page