(data stored in ACNUC30630 zone)

EMBL: AE017283.PE268

AE017283.PE268       Location/Qualifiers
FT   CDS_pept        324030..324707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82033"
FT                   /db_xref="GOA:Q6AB33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB33"
FT                   /protein_id="AAT82033.1"
FT                   /translation="MMMPVSGEHDPKRVEKDTGERRGVLALLIVATIVAAVCGVVPSIW
FT                   AVRAGVLVALVGAWISVFMAWRQVDAIRRMHFDTLKELRHAASEQEKRHHAESMEMIDT
FT                   FSRRVGSISKTLADTRAKLDRAESELSTLRGDKAALQYKVTAGNKKVASLEMRITELET
FT                   ELDALLADGRSGRLTTLRTVTDAGVPTAEEIWERGNDATIADLSRVAFPRLSEGTRETR
FT                   RQA"
     atgatgatgc ccgtgagcgg tgagcatgat cccaaacggg ttgaaaagga cactggcgag        60
     cgcagaggtg tgctcgccct tctcattgtg gcaacgattg ttgccgctgt gtgtggggta       120
     gttccctcta tttgggcggt ccgggctggt gtgctcgttg ccctcgtggg ggcttggatt       180
     tctgtcttta tggcgtggcg ccaagttgat gccattcgcc ggatgcattt cgacaccctc       240
     aaggagcttc gtcacgccgc ctcggagcag gagaagcgtc atcatgccga gtccatggag       300
     atgattgaca ccttctcgcg tcgggttggc tctatctcga aaacccttgc tgatacccgt       360
     gccaagctcg atcgtgcaga gagcgagctg tcgaccctac gcggcgacaa ggcggctctg       420
     cagtacaagg tcaccgctgg caacaagaag gttgcttccc ttgagatgcg tattaccgag       480
     ctggagacag agcttgatgc tctgctggct gacggtcggt ccgggcgcct gaccaccctg       540
     cgtaccgtca ctgatgcagg tgtccccacc gccgaggaga tctgggagcg cggtaacgac       600
     gcgactatcg ctgatctgtc ccgagtcgct ttcccgcgct tatctgaggg gactcgcgag       660
     actcgtcgcc aggcctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page