(data stored in ACNUC30630 zone)

EMBL: AE017283.PE283

AE017283.PE283       Location/Qualifiers
FT   CDS_pept        complement(339311..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0290"
FT                   /product="putative two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82048"
FT                   /db_xref="GOA:Q6AB18"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB18"
FT                   /protein_id="AAT82048.1"
FT                   /translation="MIEYEVVGDDRRPAVWLSIVLIAIGILGCFTSTAFCPLALRMTAQ
FT                   NPSGLTVLHGVAALVADMVLPVWLLWRHRQPFTITLVTAAISLVLPIGNTVPLIALACL
FT                   LGRRRGAASWWATAAVTITTTIVGIVDAARSPKAASTIKTLLSPANTPDAADLTVSWFT
FT                   VAAFIAAGLIISIGSGLWRRTQRATTSLTRERDVAQATNAKLGDELSRREERERIAQEI
FT                   HDQLGHRLSLLSLQSGALETQLRDNPDVVKAAHEVQAGAAAAVNDLHSLLSVLTESRVT
FT                   PDLPLSKLAEVIDESFGAGQPLNSSVFIEDADRVDPAVSRAVYRIVQELLTNAAKHAPG
FT                   QTTTLRIRGNPRDGISIDATNGYIGGWAGGPSAHSRGLRGITERVELLGGSLHYGLDDN
FT                   LFHVHVDIPWQ"
     atgatcgagt acgaagtcgt gggcgacgat cgcaggcccg ctgtttggct gtccatcgtc        60
     ctcatcgcca tcggaatact cggatgcttc acctcgaccg cgttctgtcc actggccctc       120
     cgcatgacgg cgcagaatcc ctccggtctc accgtgctgc acggagtcgc cgccctcgtc       180
     gcagatatgg ttttgccggt ctggctgcta tggcgacatc gtcaaccatt cacgatcacc       240
     ctcgtcacag cggcaatcag cctggtccta ccgatcggta acactgttcc tctcatcgcc       300
     ctggcatgtt tgctgggacg acgacgtggc gcagcatcat ggtgggccac cgcagccgtg       360
     acgatcacga ccaccatcgt gggaattgtg gacgccgcca ggtctccgaa agccgcgtcg       420
     acgatcaaaa ctctcttgtc cccagcaaac acccctgacg ctgctgacct gacagtctct       480
     tggttcaccg ttgcggcctt catcgccgcc gggctcatca tctccattgg ttcggggctg       540
     tggcgccgca cccaacgcgc gacgacctca cttacccggg agcgcgacgt cgcgcaggcc       600
     accaacgcca aactcggcga cgaactgtca cgccgtgaag aacgcgagcg catcgctcag       660
     gaaatccacg atcaactcgg ccatagattg tcccttctca gcctgcagtc cggggcgcta       720
     gagactcaac ttcgggacaa tccggacgtc gtcaaggccg cccacgaggt acaggctggg       780
     gcagctgcag ccgtcaatga cctgcattcc ctgctgtcgg tgcttaccga gtcccgcgtg       840
     acaccggact tgcccctgtc gaaactggcc gaggtcattg acgagtcctt cggcgccggt       900
     cagcctctca attcgagcgt cttcattgag gacgccgatc gcgtcgatcc cgctgtgtcg       960
     agggccgtct accgcatcgt tcaggagctg ctcactaacg cggccaagca cgcacccggg      1020
     cagacgacga ccctgcgcat acgcggaaat ccccgagacg gaatcagcat cgacgcgacg      1080
     aacggctaca tcggtggatg ggctggtggg ccgagtgccc attcccgcgg gcttaggggg      1140
     atcaccgagc gtgtcgagct acttgggggc agccttcact acggtcttga tgacaatctg      1200
     ttccacgtcc atgtggacat cccgtggcag tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page