(data stored in ACNUC30630 zone)

EMBL: AE017283.PE291

AE017283.PE291       Location/Qualifiers
FT   CDS_pept        complement(349234..350163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0299"
FT                   /product="putative regulatory protein, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82056"
FT                   /db_xref="GOA:Q6AB10"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB10"
FT                   /protein_id="AAT82056.1"
FT                   /translation="MDRPPKQTESSSDAAGLSLEAVLKLDQPNHVTDQDTMSTTPKQPR
FT                   TATAARRRHIVDHLRSLGHSESIGDLSQLFGVSTSTIRRDVDALSDESKIWKISGGDVM
FT                   IRRHEPTWHEKEQCEHVSKAAMATYAAKHLVNESDLVLLDSGTSTAALGRLLSTRNDIT
FT                   ILVGGLSVLQAVAEGTANVMVLGGALRQHSGSLLGPWASSNLRSITPDVAFIGCDAVSA
FT                   TDGLNCPLLESVEFKHEAMTRARTSWILADPTKILTTGSEPYWASIPPRTGIVTVQSSN
FT                   SELSEKLGAFRRSGHHVIQAPLQPADTD"
     ttggaccgac cacccaaaca gaccgagtcc agcagtgatg ccgctgggtt atccttagag        60
     gcggtcctca aattggatca gccaaaccac gtcaccgatc aagacaccat gagcacaaca       120
     cccaaacagc cgcgcacggc gacagctgcc cgacgccgac acattgtcga ccatctgcgt       180
     tctttggggc actcggagtc catcggagat ctttcccaac tgttcggtgt ctctacatcg       240
     acgattcgcc gcgatgtcga tgccctctcg gatgaatcca agatctggaa gatttccggg       300
     ggagacgtca tgatccgacg acacgagcct acctggcacg agaaggaaca atgcgagcac       360
     gtctccaagg cagcaatggc cacatatgcc gccaaacacc tcgtgaacga gagtgaccta       420
     gttctgctcg attccggaac gtccaccgca gcactgggcc gccttctgtc gactcgtaac       480
     gacatcacca tcctcgtagg cggcctgtcc gtgctccagg ccgtggccga aggcaccgcc       540
     aacgtcatgg tgctcggcgg ggcgttaagg cagcacagcg gaagccttct gggaccgtgg       600
     gcgtcatcaa acctgcgcag catcacccct gatgtcgcgt tcatcggctg cgacgcagtc       660
     tctgcgaccg acgggctcaa ctgcccactc ctggagtccg tcgagttcaa acacgaagcg       720
     atgacgcggg ctcgcacgtc gtggatcctc gctgatccca ccaagatcct caccaccggt       780
     agcgaaccat attgggcatc gataccgccc cggacgggga tcgtcaccgt ccagtcgtcg       840
     aacagtgagc tgagcgagaa gctcggtgcc ttccgccgga gcggacacca cgtcatccaa       900
     gcgccccttc agcctgcaga caccgactga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page