(data stored in ACNUC30630 zone)

EMBL: AE017283.PE312

AE017283.PE312       Location/Qualifiers
FT   CDS_pept        371940..372281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0321"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82077"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY9"
FT                   /protein_id="AAT82077.1"
FT                   /translation="MWRHQHGMAALRSGELRPLDPLVEGRVIIVTRQGCHLCDEVIGLV
FT                   ARLRQEHRDLVPEPMIVDVDANEDFRSRWGDHVPVIFVDGTLISYWTLDADTFLSALRD
FT                   GPSLPAVLP"
     atgtggcggc atcaacatgg catggctgcc ctccgcagcg gtgaattacg gcccctcgac        60
     ccgctggtcg aggggcgcgt cattattgtc acccgacagg gctgtcattt gtgcgatgag       120
     gtcatcggcc tcgttgcacg tttgagacag gaacatcgcg atctcgtgcc tgaaccgatg       180
     atcgttgacg tcgatgccaa tgaggacttt cgctcccgct ggggcgatca tgtcccggta       240
     attttcgttg atggcacgct tatctcctat tggacccttg acgctgacac cttcctgtca       300
     gccttacgtg atggcccctc gctcccggca gtgttgccct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page