(data stored in ACNUC30630 zone)

EMBL: AE017283.PE318

AE017283.PE318       Location/Qualifiers
FT   CDS_pept        377769..378650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0328"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82083"
FT                   /db_xref="GOA:Q6AAY3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY3"
FT                   /protein_id="AAT82083.1"
FT                   /translation="MSVENLSAVGIVTAAVLYMLAFLAHAVEWASVRGTEHPSHEERLR
FT                   SETWGRMGLNLTVLGAACAAIGVVCRGIAAHRLPWGNMYEFVTSALFFVVIAYLVLVAI
FT                   HHVRWMGIAVTLLLAVGNGLAATVFYVAVAPLVPALHSVWFVIHIVAACIAAAALNVGA
FT                   IASIMYLIATNAQAKAQRTGVLVAKLPPLESMDALAYRAHAIGFPIWTFTIAAGSVWAD
FT                   YAWGRFWGWDPKETWSLVTWVVYAAYLHARSTAGWRGRRAALIAIVGAACFWFNFVGVN
FT                   LIFNGLHSYAGI"
     gtgagtgtgg agaatctgtc tgccgttggg atcgtcaccg cggcggtgct ctatatgctt        60
     gccttcctcg cccacgccgt ggagtgggcc agtgtgcggg ggaccgaaca tcccagccac       120
     gaggagcgtc tgcgctcgga aacgtggggt cgtatggggc tcaacctcac cgtgctgggt       180
     gcggcttgcg cagcaatcgg tgtcgtctgc cgtggtattg ctgctcatcg gttgccctgg       240
     ggcaacatgt acgaattcgt tacctcggcg ctgttcttcg tcgtcatcgc ctaccttgtg       300
     ctcgtcgcca tccaccacgt cagatggatg ggtatcgccg tcaccctgct gctagcagtt       360
     ggtaacgggc tggcagcaac ggtgttctac gtggccgtag cgccgctcgt gccggctctg       420
     cattccgtgt ggttcgttat tcacatcgtt gccgcttgta tcgctgcagc cgccctcaac       480
     gtcggggcta tcgcctcaat catgtacctc atcgccacga acgcccaggc aaaggcccaa       540
     cggaccggag ttctggtggc aaaattgcct cccctggaat ccatggacgc tctggcatat       600
     cgcgcccacg cgatcggctt cccgatctgg accttcacta tcgctgctgg ttcggtgtgg       660
     gctgactacg cctggggacg cttctgggga tgggatccca aggagacgtg gtctttggtg       720
     acctgggtgg tctacgcggc ttacctccac gcccggtcca ctgccggatg gcgcggtcgc       780
     cgggccgccc tgatagcgat cgttggtgcg gcctgtttct ggtttaattt cgtcggtgtc       840
     aatttgatct ttaacggtct tcactcgtat gccggaatct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page